Clone Name | rbart20c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PIVA2_ADECT (P87552) Maturation protein (Protein IVA2) | 29 | 5.1 | 2 | GLE1_MOUSE (Q8R322) Nucleoporin GLE1 (GLE1-like protein) | 29 | 5.1 | 3 | SRY_MUSSP (Q62563) Sex-determining region Y protein (Testis-dete... | 28 | 8.8 |
---|
>PIVA2_ADECT (P87552) Maturation protein (Protein IVA2)| Length = 446 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 207 HERTPARSILHSHVEQGNKQPSSISGPSPAC 299 H+R R+ HS NK+ ++ G +PAC Sbjct: 22 HQRAGPRATFHSDRNHPNKEAEAMEGQNPAC 52
>GLE1_MOUSE (Q8R322) Nucleoporin GLE1 (GLE1-like protein)| Length = 699 Score = 28.9 bits (63), Expect = 5.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 177 LTKSKQEFTKHERTPARSILHSHVEQGNKQPSSISGPSPA 296 +T++ Q KHE S V+QG P+ S PSP+ Sbjct: 331 ITRASQVKKKHEEEAKVKRQESQVQQGPAPPTQTSAPSPS 370
>SRY_MUSSP (Q62563) Sex-determining region Y protein (Testis-determining| factor) Length = 355 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/65 (21%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 63 KYNDQIQSDINAHTFCHRKEEEK-STHVHHTT*PLHIMNLTKSKQEFTKHERTPARSILH 239 +++D Q H H++++++ H HH + + KQ+F H + + H Sbjct: 199 QFHDHQQQQQQFHDHHHQQQQQQFHDHHHHQQQQQQFHDHHQQKQQFHDHHQQQQQQQFH 258 Query: 240 SHVEQ 254 H +Q Sbjct: 259 DHPQQ 263 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,968,859 Number of Sequences: 219361 Number of extensions: 1217345 Number of successful extensions: 2977 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2976 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)