Clone Name | rbart20b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | 6PGD_SHEEP (P00349) 6-phosphogluconate dehydrogenase, decarboxyl... | 30 | 2.1 | 2 | 6PGD_HUMAN (P52209) 6-phosphogluconate dehydrogenase, decarboxyl... | 30 | 2.1 | 3 | MASS1_BRARE (Q6JAN0) Monogenic audiogenic seizure susceptibility... | 28 | 4.6 | 4 | PARB2_XYLFA (Q9PHE9) Probable plasmid partitioning protein parB | 28 | 6.0 |
---|
>6PGD_SHEEP (P00349) 6-phosphogluconate dehydrogenase, decarboxylating (EC| 1.1.1.44) Length = 482 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 199 KEAEPHESRFPSGSDAQVTSGRPCCD 276 KEA PH G A+V +G PCCD Sbjct: 146 KEAWPHIKAIFQGIAAKVGTGEPCCD 171
>6PGD_HUMAN (P52209) 6-phosphogluconate dehydrogenase, decarboxylating (EC| 1.1.1.44) Length = 482 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 199 KEAEPHESRFPSGSDAQVTSGRPCCD 276 KEA PH G A+V +G PCCD Sbjct: 146 KEAWPHIKTIFQGIAAKVGTGEPCCD 171
>MASS1_BRARE (Q6JAN0) Monogenic audiogenic seizure susceptibility protein 1| homolog precursor (Very large G-protein coupled receptor 1) Length = 6199 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 190 PILKEAEPHESRFPSGSDAQVTSGRPCCDGSES 288 P E +PH R +G+DA SGRP GS S Sbjct: 1300 PSAVELQPHSRRRHAGTDALFFSGRPGAYGSIS 1332
>PARB2_XYLFA (Q9PHE9) Probable plasmid partitioning protein parB| Length = 401 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 Query: 227 NRLSWGSASFKIGGIFKPILLCENTESY 144 N L +AS K+ G+ +PILL N+E Y Sbjct: 75 NTLEDLAASIKVRGVLQPILLRSNSEGY 102 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.131 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,166,821 Number of Sequences: 219361 Number of extensions: 799011 Number of successful extensions: 1931 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1931 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)