ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart20b05 |
|---|---|
| Clone Library Name | barley_pub |
>AT11C_HUMAN (Q8NB49) Probable phospholipid-transporting ATPase IG (EC 3.6.3.1)| (ATPase class I type 11C) (ATPase IG) (ATPase IQ) (ATPase class VI type 11C) Length = 1132 Score = 32.0 bits (71), Expect = 0.40 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 211 YFFFLRIPRSIPTWVYVLLCLFVSLFARV 125 YF F ++ S+ TW+ ++L +F+SLF + Sbjct: 1057 YFVFAQMLSSVSTWLAIILLIFISLFPEI 1085
>AT11C_MOUSE (Q9QZW0) Probable phospholipid-transporting ATPase 11C (EC 3.6.3.1)| (Fragment) Length = 347 Score = 31.2 bits (69), Expect = 0.69 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 211 YFFFLRIPRSIPTWVYVLLCLFVSLFARV 125 YF F ++ S+ TW+ ++L +F+SLF + Sbjct: 285 YFVFAQMLCSVSTWLAIILLIFISLFPEI 313
>ITPR1_HUMAN (Q14643) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP3R) Length = 2758 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>TPTE_HUMAN (P56180) Putative tyrosine-protein phosphatase TPTE (EC 3.1.3.48)| (Transmembrane phosphatase with tensin homology) (Protein BJ-HCC-5) Length = 551 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = -2 Query: 208 FFFLRIPRSIPTWVYVLLCLFVSLFARVGRLYDQQ 104 FF +++ R+IP W ++L L + + R+ L+ Q+ Sbjct: 178 FFDIKLLRNIPRWTHLLRLLRLIILLRIFHLFHQK 212
>ITPR3_BOVIN (Q8WN95) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2664 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ATL1G_ARATH (Q570X5) RING-H2 finger protein ATL1G| Length = 261 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 201 SFVFHVPFPLGFMYCFVYLLVYLRGSGDYTTS 106 +F+F VP F+ F++ L+YLR S +S Sbjct: 25 AFIFSVPICFTFIILFLFYLIYLRRSSSDLSS 56
>ITPR_DROME (P29993) Inositol 1,4,5-trisphosphate receptor (InsP3 receptor)| (InsP3R) Length = 2838 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 622 LLHNNRKLLEKHIT 635
>ITPR3_HUMAN (Q14573) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2671 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_RAT (P29995) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_MOUSE (Q9Z329) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) (Inositol 1,4,5-trisphosphate type V receptor) Length = 2701 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_HUMAN (Q14571) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR2_BOVIN (Q8WN96) Inositol 1,4,5-trisphosphate receptor type 2 (Type 2| inositol 1,4,5-trisphosphate receptor) (Type 2 InsP3 receptor) (IP3 receptor isoform 2) (InsP3R2) Length = 2701 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_RAT (P29994) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (IP-3-R) Length = 2750 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_MOUSE (P11881) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) (Inositol 1,4,5-trisphosphate-binding protein P400) (Purkinje cell protein 1) (Pro Length = 2749 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR1_BOVIN (Q9TU34) Inositol 1,4,5-trisphosphate receptor type 1 (Type 1| inositol 1,4,5-trisphosphate receptor) (Type 1 InsP3 receptor) (IP3 receptor isoform 1) (InsP3R1) Length = 2709 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_RAT (Q63269) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) (IP3R-3) Length = 2670 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>ITPR3_MOUSE (P70227) Inositol 1,4,5-trisphosphate receptor type 3 (Type 3| inositol 1,4,5-trisphosphate receptor) (Type 3 InsP3 receptor) (IP3 receptor isoform 3) (InsP3R3) Length = 2670 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +2 Query: 62 LLHNKTKLLEKHIT 103 LLHN KLLEKHIT Sbjct: 598 LLHNNRKLLEKHIT 611
>TPTE2_MACFA (Q4R6N0) Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase| TPTE2 (EC 3.1.3.67) Length = 566 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/56 (21%), Positives = 29/56 (51%) Frame = -2 Query: 271 LVNLFPVLCVMRDV*CSPISYFFFLRIPRSIPTWVYVLLCLFVSLFARVGRLYDQQ 104 L+N+ ++ + + FF ++ R+IP W++++ L + + R+ L Q+ Sbjct: 201 LLNVLDTAIIVTPLLVDVVYIFFDIKFLRNIPRWIHLVRLLRLIILIRIFHLIHQK 256
>POL4_DROME (P10394) Retrovirus-related Pol polyprotein from transposon 412| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1237 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 11 GPVLVRTTSDNNNITHILLHNKTKLLEK 94 GP + + DNNNIT + NK +++ K Sbjct: 1202 GPYKIESIGDNNNITLLTNKNKKQIVHK 1229 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,321,396 Number of Sequences: 219361 Number of extensions: 946407 Number of successful extensions: 2317 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 2277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2316 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
