Clone Name | rbart20a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27) | 31 | 1.0 | 2 | VGLG_CHAV (P13180) Spike glycoprotein precursor | 30 | 2.9 | 3 | NGF_BOVIN (P13600) Beta-nerve growth factor precursor (Beta-NGF)... | 28 | 8.6 |
---|
>CATS_RAT (Q02765) Cathepsin S precursor (EC 3.4.22.27)| Length = 330 Score = 31.2 bits (69), Expect = 1.0 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 37 YLVITNADYSAKFIYRGKDESSTRPSSNHTTPCFKYISKAFPDQ 168 Y++ T+ D A + Y+ DE N C +YI F D+ Sbjct: 190 YIIDTSIDSEASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDE 233
>VGLG_CHAV (P13180) Spike glycoprotein precursor| Length = 524 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 127 TPCFKYISKAFPDQTKF-WKPTRR 195 TP + Y+S AFP+ TK WKP + Sbjct: 17 TPLYSYLSIAFPENTKLDWKPVTK 40
>NGF_BOVIN (P13600) Beta-nerve growth factor precursor (Beta-NGF) (Fragment)| Length = 231 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +2 Query: 59 TIVPNLYIEERMRAPRDRAATTPHPALNTSQRLSLTKPSSGSLHEEFR 202 T+ P L+ + R+R+PR +T P P +Q L + S + R Sbjct: 61 TVDPKLFKKRRLRSPRVLFSTQPPPVAADTQDLDFEAGGASSFNRTHR 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,018,920 Number of Sequences: 219361 Number of extensions: 474350 Number of successful extensions: 1207 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)