Clone Name | rbart19g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UFD4_YEAST (P33202) Ubiquitin fusion degradation protein 4 (UB f... | 30 | 3.5 | 2 | YIIE_SHIFL (P0ADQ6) Hypothetical protein yiiE | 30 | 4.6 | 3 | YIIE_ECOLI (P0ADQ5) Hypothetical protein yiiE | 30 | 4.6 | 4 | SNF5_YEAST (P18480) Transcription regulatory protein SNF5 (SWI/S... | 29 | 7.8 |
---|
>UFD4_YEAST (P33202) Ubiquitin fusion degradation protein 4 (UB fusion protein 4)| Length = 1483 Score = 30.0 bits (66), Expect = 3.5 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 354 AAKSGNWKRCSSFS----MDCRTSDDPVTXXXXPQPV 452 A KS N RC+S+S MD T+DD +T P+P+ Sbjct: 1155 ARKSLNMWRCNSYSYRSEMDVDTTDDYITTLLFPEPL 1191
>YIIE_SHIFL (P0ADQ6) Hypothetical protein yiiE| Length = 70 Score = 29.6 bits (65), Expect = 4.6 Identities = 14/41 (34%), Positives = 28/41 (68%) Frame = -3 Query: 469 ERIDIVTGWGRRSRVTGSSLVRQSIEKLLHLFQFPLFAARG 347 +R++ + GW + SR S+++R+++E+ L QFP+ A+G Sbjct: 14 KRLNKLRGWRKVSR---SAILREAVEQYLERQQFPVRKAKG 51
>YIIE_ECOLI (P0ADQ5) Hypothetical protein yiiE| Length = 70 Score = 29.6 bits (65), Expect = 4.6 Identities = 14/41 (34%), Positives = 28/41 (68%) Frame = -3 Query: 469 ERIDIVTGWGRRSRVTGSSLVRQSIEKLLHLFQFPLFAARG 347 +R++ + GW + SR S+++R+++E+ L QFP+ A+G Sbjct: 14 KRLNKLRGWRKVSR---SAILREAVEQYLERQQFPVRKAKG 51
>SNF5_YEAST (P18480) Transcription regulatory protein SNF5 (SWI/SNF complex| component SNF5) (Transcription factor TYE4) Length = 905 Score = 28.9 bits (63), Expect = 7.8 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 294 LCSHWLSGSPHPTKQPVLPRAAKS 365 + +H ++ SP+PT QPV+P A S Sbjct: 843 IANHTVTNSPNPTLQPVIPGGAAS 866 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,935,824 Number of Sequences: 219361 Number of extensions: 714265 Number of successful extensions: 2086 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2086 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)