Clone Name | rbart19f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEPA_HHV2H (P89431) DNA helicase/primase complex-associated protein | 29 | 5.9 | 2 | SEY1_KLULA (Q6CJ97) Protein SEY1 | 28 | 7.7 |
---|
>HEPA_HHV2H (P89431) DNA helicase/primase complex-associated protein| Length = 752 Score = 28.9 bits (63), Expect = 5.9 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -3 Query: 205 ISARAYLSSFLNPRTRRCLYALVYL 131 +SA + +L PRTR CL+AL+YL Sbjct: 13 VSAITLYAVWLPPRTRDCLHALLYL 37
>SEY1_KLULA (Q6CJ97) Protein SEY1| Length = 786 Score = 28.5 bits (62), Expect = 7.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 326 TFHREVKRNKERMVLWLLRRVSLFRSTPGQQSLPDCF 436 T +VKR + +WL +++ S QS+PD F Sbjct: 65 TMDAQVKRQQTTRGIWLSHSANIYSSGAANQSIPDFF 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,063,856 Number of Sequences: 219361 Number of extensions: 1172848 Number of successful extensions: 2767 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2766 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)