Clone Name | rbart19f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NMDE4_HUMAN (O15399) Glutamate [NMDA] receptor subunit epsilon 4... | 29 | 3.0 | 2 | AMY_BUTFI (P30269) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alp... | 28 | 5.1 | 3 | KLK13_HUMAN (Q9UKR3) Kallikrein-13 precursor (EC 3.4.21.-) (Kall... | 28 | 6.7 |
---|
>NMDE4_HUMAN (O15399) Glutamate [NMDA] receptor subunit epsilon 4 precursor| (N-methyl D-aspartate receptor subtype 2D) (NR2D) (NMDAR2D) (EB11) Length = 1336 Score = 29.3 bits (64), Expect = 3.0 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 Query: 177 PPDPPWQGAPLQQFQFHQGPLVIHPHR 97 PP PPW PL + + G HPHR Sbjct: 1209 PPPPPWAAGPLPRRRARCGCPRSHPHR 1235
>AMY_BUTFI (P30269) Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) Length = 976 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 17 SIGFSSKFYFLYFFNIKPWDTQHGCNKRWGWITRGPW 127 ++G S + YF+N + WD C WG G W Sbjct: 813 ALGVSGSYTTAYFYNTEGWDKV--CAYTWGATALGDW 847
>KLK13_HUMAN (Q9UKR3) Kallikrein-13 precursor (EC 3.4.21.-) (Kallikrein-like| protein 4) (KLK-L4) Length = 277 Score = 28.1 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 180 FPPDPPWQGAPLQQFQFHQGPLVIHPHRLLHPC-CVSQG 67 FP PWQ A L Q + G +++HP +L C+ +G Sbjct: 43 FPHSQPWQAALLVQGRLLCGGVLVHPKWVLTAAHCLKEG 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,290,238 Number of Sequences: 219361 Number of extensions: 519674 Number of successful extensions: 1045 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1044 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)