| Clone Name | rbart19b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y338_MYCGE (P47580) Hypothetical lipoprotein MG338 precursor | 28 | 4.7 | 2 | GLNA_BACFR (P15623) Glutamine synthetase (EC 6.3.1.2) (Glutamate... | 28 | 8.1 |
|---|
>Y338_MYCGE (P47580) Hypothetical lipoprotein MG338 precursor| Length = 1271 Score = 28.5 bits (62), Expect = 4.7 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 43 WQNLRSNSLGGLKLIMSSIKLSRGGKKGLFRLVNEFLSSDKDNNHLLQ*QKIL-GAKQVT 219 W+N ++NSLG K I S+ + + +G L L + H + Q+IL G K++ Sbjct: 1198 WKNNKANSLGLKKEIFMSLLIEQALDEGTQELAFLDLIRENQKQHQREHQQILVGDKRLY 1257 Query: 220 DTVPST 237 D + T Sbjct: 1258 DILGQT 1263
>GLNA_BACFR (P15623) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 729 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 6/35 (17%) Frame = +2 Query: 95 ASNFPGG------EKKGYFAWLMSSSHLIKTITIC 181 AS+FP G E +GY AW +SS + T+C Sbjct: 130 ASSFPNGGIRNTFEARGYTAWDVSSPAFVVDTTLC 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,013,008 Number of Sequences: 219361 Number of extensions: 834430 Number of successful extensions: 1890 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1890 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)