Clone Name | rbart18h12 |
---|---|
Clone Library Name | barley_pub |
>FKBP3_CANGA (Q6FKH7) FK506-binding protein 3 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 437 Score = 30.8 bits (68), Expect = 1.9 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 466 EEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENE 359 EE E + ++E K+K + H HHH HD +++ Sbjct: 240 EEIEASEEEESEEEEKKSKHKKHDHHHHHDHDHDHD 275 Score = 30.4 bits (67), Expect = 2.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARK 329 +A EEEE + K + K H HHH HD +++ D + K Sbjct: 243 EASEEEESEEEEKKSKHKK-------HDHHHHHDHDHDHDHEHKSKNK 283
>DAXX_HUMAN (Q9UER7) Death domain-associated protein 6 (Daxx) (hDaxx) (Fas| death domain-associated protein) (ETS1-associated protein 1) (EAP1) Length = 740 Score = 30.4 bits (67), Expect = 2.4 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELA 335 +++EEEE+ ++++E T ++ Q + + E DE EE A Sbjct: 442 ESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAA 487
>LEGB_PEA (P14594) Legumin B [Contains: Legumin B alpha chain (Legumin B| acidic chain); Legumin B beta chain (Legumin B basic chain)] (Fragment) Length = 338 Score = 30.4 bits (67), Expect = 2.4 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEE 341 + +EEEE H Q K+E + + R H+ H + E+E +E EE Sbjct: 50 ELQEEEEQSHSQRKEEEEEEQEQR--HRKHSKKEDEDEDEEEEE 91
>DAXX_CERAE (O18805) Death domain-associated protein 6 (Daxx)| Length = 736 Score = 30.4 bits (67), Expect = 2.4 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARKLGE 320 +++EEEE+ ++++E T + Q + + E +E EE A K G+ Sbjct: 442 ESDEEEEEEEEEEEEEATDFEEEEDLEQMQEGQEDDEEEEEEEEAAGKDGD 492
>ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 20) (DHHC-20) Length = 380 Score = 29.6 bits (65), Expect = 4.1 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -2 Query: 164 CCVRCVTWSALPFPTFIFASYSTLHYHLGLCVSLFVRVG 48 CC R V W + F TF+ +S Y + LCVS R G Sbjct: 9 CCQRVVGWVPVLFITFVVV-WSYYAYVVELCVSTISRTG 46
>DAXX_CANFA (Q5TJE1) Death domain-associated protein 6 (Daxx)| Length = 737 Score = 29.3 bits (64), Expect = 5.4 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARKLGE 320 ++EEEEE+ ++++E T ++ Q + E +E EE A + G+ Sbjct: 442 ESEEEEEEEEEEEEEEATDSEEEEDLEQMQEGQGDDEEEEEEEEEAGQDGD 492
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 29.3 bits (64), Expect = 5.4 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = -3 Query: 460 EEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEE 341 EEE+ D DEG + R H H E + D+ +E Sbjct: 260 EEEEDEEDDDDEGDSTESDRHQAHRHRGHREEEDEDDDDE 299
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 7.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 421 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 329 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199
>TRI41_HUMAN (Q8WV44) Tripartite motif protein 41| Length = 630 Score = 28.9 bits (63), Expect = 7.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 472 DAEEEEEDGHRQDKDE-GTKAKLFRRFHQHHHAHDSENEVDEVEE 341 D EEEEEDG ++ + G A + D E EV+E EE Sbjct: 60 DREEEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEE 104
>SCG1_RAT (O35314) Secretogranin-1 precursor (Secretogranin-I) (SgI)| (Chromogranin B) (CgB) (Glucagonoma peptide) [Contains: GAWK peptide; CCB peptide] Length = 675 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 469 AEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENE 359 +EEE E+G ++ +EG +++ +R +HHH N+ Sbjct: 255 SEEESEEG--EEGEEGATSEVTKRRPRHHHWRSQSNK 289
>YTZ4_AGRVI (P70796) Hypothetical 31.6 kDa protein in TAR-I ttuC' 3'region| (ORFZ4) Length = 280 Score = 28.5 bits (62), Expect = 9.2 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -3 Query: 469 AEEEEEDGHRQDKDEGTKAKLFRRFHQHHHAHDSENEVDEVEELARKLGEA 317 AE ED D G AK+F + HH D++ + V E+A LG+A Sbjct: 25 AENRAEDS-AADHRSGDPAKIFLAEPEVHHPLDADFAIALVLEIAEDLGDA 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,547,142 Number of Sequences: 219361 Number of extensions: 890788 Number of successful extensions: 4220 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4023 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)