Clone Name | rbart18g04 |
---|---|
Clone Library Name | barley_pub |
>RPN5_YEAST (Q12250) 26S proteasome regulatory subunit RPN5 (Proteasome| non-ATPase subunit 5) Length = 445 Score = 28.9 bits (63), Expect = 3.1 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 186 GTSNIHAWI*LIKHEKSHSSKKLIKVVLQLSSLRTNMLDLCTRSQTYTYWS 338 G +N H W L K H+ + + + +++ LR N L T SQT TY S Sbjct: 331 GEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYIS 381
>GOGA5_BRARE (Q7SXE4) Golgin subfamily A member 5 (Golgin-84)| Length = 760 Score = 28.5 bits (62), Expect = 4.0 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +3 Query: 219 IKHEKSHSSKKLIKVVLQLSSLRTNMLDLCTRSQT 323 ++HEK +++ K+ Q+ SLRT + DL T++ T Sbjct: 501 LRHEKELQREEIQKLQAQIQSLRTEIQDLETQALT 535
>CHS2_SCHPO (O74756) Chitin synthase-like protein 2| Length = 926 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 240 SSKKLIKVVLQLSSLRTNMLDLCTRSQTYTYWSQSRFTLHTWNKLL 377 S + L + LSS+ N+ LC+RS++ + ++S W K+L Sbjct: 254 SDEDLASFAISLSSIMNNLKHLCSRSKSRVWGNES------WEKVL 293
>Y005_NPVAC (P41420) Hypothetical 12.4 kDa protein in CTL-LEF2 intergenic| region (ORF5) Length = 109 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 270 QLSSLRTNMLDLCTRSQT 323 +L+SLR N+ DLCTRS T Sbjct: 27 ELNSLRRNVHDLCTRSGT 44
>NUOM_BUCBP (Q89AT5) NADH-quinone oxidoreductase chain M (EC 1.6.99.5) (NADH| dehydrogenase I, chain M) (NDH-1, chain M) Length = 508 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = -2 Query: 269 QYYFNKFFGAVRFFVFNQLDPCMYITSSRLQV 174 ++Y+N F A +FF+++Q+ + + S+ + V Sbjct: 165 KFYYNNIFSANKFFIYSQISGLVLLLSTLVLV 196
>RNC_WOLTR (Q5GTI3) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 243 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 85 ILTEALSHPCLNSINHKAQSHKLDR 159 IL EAL+HP LN N K Q +R Sbjct: 31 ILEEALTHPSLNKRNSKNQIENYER 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,214,793 Number of Sequences: 219361 Number of extensions: 950131 Number of successful extensions: 1961 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1961 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 1365190992 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)