| Clone Name | rbart18f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IFB2_CAEEL (Q19286) Intermediate filament protein ifb-2 (Interme... | 31 | 1.5 | 2 | NKX32_MOUSE (P97503) Homeobox protein Nkx-3.2 (Bagpipe homeobox ... | 29 | 4.3 |
|---|
>IFB2_CAEEL (Q19286) Intermediate filament protein ifb-2 (Intermediate filament| protein B2) (IF-B2) (Cel IF B2) Length = 543 Score = 30.8 bits (68), Expect = 1.5 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -3 Query: 345 SGAYSGARGVEEAVRRLRADLPTCHHPTVPEVKRSTRRSTSSW 217 S A+SG GVE V RLR DL H E +R R ++W Sbjct: 101 SEAHSGTIGVEVKVDRLRDDLNDYRH-RYEEARREVEREKTTW 142
>NKX32_MOUSE (P97503) Homeobox protein Nkx-3.2 (Bagpipe homeobox protein homolog| 1) Length = 333 Score = 29.3 bits (64), Expect = 4.3 Identities = 22/64 (34%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Frame = -3 Query: 369 QENHGGQRSGAYSGARGVEEAVRRLRADLPTCH-HPTVPEVKRSTRRSTSSWEYICSIDL 193 +EN G +R GA G A L D P C HP + + RS S S D Sbjct: 99 EENEGRRRCADVPGASGTGRARVTLGLDQPGCELHPAKDLEEEAPVRSDSEMSASVSGDH 158 Query: 192 SPLG 181 SP G Sbjct: 159 SPRG 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,580,226 Number of Sequences: 219361 Number of extensions: 957756 Number of successful extensions: 2498 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2498 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)