Clone Name | rbart18d10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZN434_HUMAN (Q9NX65) Zinc finger protein 434 | 31 | 1.6 | 2 | PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Pla... | 28 | 7.7 |
---|
>ZN434_HUMAN (Q9NX65) Zinc finger protein 434| Length = 485 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +1 Query: 151 SRLYKARSGHPRDTRERQCHDDRIHQSDK*PSQEAIKRK----RPAACTRRHCGDPC 309 S L K P T RQC + +K PSQE + + R ACT CG C Sbjct: 237 SELQKGLESEP--TSRRQCRNSPGESEEKTPSQEKMSHQSFCARDKACTHILCGKNC 291
>PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Plasmalemma| vesicle protein 1) (PV-1) (MECA-32 antigen) Length = 438 Score = 28.5 bits (62), Expect = 7.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 103 DQQEGCVYFFSSLILWQTIIYVTDYYGVIYFILY 2 DQQ GC Y+ L+ ++I G++ F++Y Sbjct: 15 DQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIY 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,468,586 Number of Sequences: 219361 Number of extensions: 664554 Number of successful extensions: 1289 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1289 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)