Clone Name | rbart18c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APOL1_HUMAN (O14791) Apolipoprotein-L1 precursor (Apolipoprotein... | 32 | 0.65 |
---|
>APOL1_HUMAN (O14791) Apolipoprotein-L1 precursor (Apolipoprotein L-I)| (Apolipoprotein L) (ApoL-I) (Apo-L) (ApoL) Length = 398 Score = 32.3 bits (72), Expect = 0.65 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 2/45 (4%) Frame = +1 Query: 100 IQAFRRAHSILRLRDHTTTAR--ATDPTNKEQGLQTERSTYPSVL 228 I+A RRA + L+ H + +R T+P + E G Q ER PS+L Sbjct: 283 IRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSIL 327 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,911,322 Number of Sequences: 219361 Number of extensions: 558403 Number of successful extensions: 1632 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1631 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)