Clone Name | rbart18c01 |
---|---|
Clone Library Name | barley_pub |
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 30.4 bits (67), Expect = 1.3 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +3 Query: 93 HPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIPPF*HGLKLKANTTH 245 HP P S P+ P+ H HP P+ + P Q S P HG +L +T++ Sbjct: 213 HPHPHSHPHSHPHP---HPHPHPHQIPHPHPQPHSQP---HGHRLLRSTSN 257
>TRUB_LEGPA (Q5X1C5) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +I+HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAIQHLT 242
>COBL6_ARATH (O04500) COBRA-like protein 6 precursor| Length = 454 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 142 SVWVYGLQFGPESGPGCCLSLFAYYYGHFV 53 +V VY QF P CC+SL A+YY + V Sbjct: 217 AVCVYS-QFRSSPSPKCCVSLSAFYYQNIV 245
>TRUB_LEGPL (Q5WT38) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>TRUB_LEGPH (Q5ZRV6) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 303 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 52 TQSARNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLT 165 T NN+ L+ +QD+ L Q A + ++ +++HLT Sbjct: 205 TAGFENNRMYTLDELQDMPLSQRLACLIPIDQAVQHLT 242
>ISPZ_HAEDU (Q7VKZ1) Probable intracellular septation protein| Length = 183 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -1 Query: 170 KPVR*RMLVFSLGIRASVWSRVR-SWMLFKFICLLLRAL 57 KPV +L L + VW+R+ W +F IC+L+ + Sbjct: 98 KPVVKMLLAKELSLPTQVWNRLNLGWAIFFIICMLINII 136
>CRK_XENLA (P87378) SH2/SH3 adaptor crk (Adapter molecule crk) (CRK2)| Length = 296 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 78 NKLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQR 191 N+ HP P GP PY Q P PN + P R Sbjct: 197 NQENSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIFAR 234
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 81 KLKQHPGPDSGPN*SPYTQTEHKHPSPNGLHRPDLQRRSIP 203 K +QHP P+ SP Q +HPSPN P ++ P Sbjct: 126 KQQQHPSPNQQQPPSPNQQ---QHPSPNQQQHPSPNQQQHP 163
>ATM_NEUCR (Q7RZT9) Serine/threonine-protein kinase tel-1 (EC 2.7.11.1)| (DNA-damage checkpoint kinase tel-1) (Telomere length regulation protein 1) (ATM homolog) Length = 2953 Score = 27.7 bits (60), Expect = 8.2 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +1 Query: 85 LNNIQDLTLDQTEARIPKLNTSIRHLTGFTDRTFKDDQSLHFDTDLNLK 231 ++N+ + LDQT+ KL+ +++ T +D+Q L +T L L+ Sbjct: 1798 VHNVLEYELDQTQGMKQKLSEALKEWLTSTSPAARDNQKLLINTILYLR 1846
>TAGF_BACSU (P13485) CDP-glycerol:poly(glycerophosphate)| glycerophosphotransferase (EC 2.7.8.12) (Polyglycerol phosphate polymerase) (CGPTase) (Major teichoic acid biosynthesis protein F) Length = 746 Score = 27.7 bits (60), Expect = 8.2 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +1 Query: 64 RNNKQINLNNIQDLTLDQTEARIPKLNTSIRHLTGFTDRTFKDDQSLHFDTDLNLKQTR 240 RN+ N NN + ++L ++ IP+ I + + D F FD DL+L Q R Sbjct: 540 RNDFLHNDNNEETISLIKSRLNIPRDKKVILYAPTWRDDQFYAKGRYKFDLDLDLHQLR 598
>POLG_ZYMVS (O36979) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3083 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = +1 Query: 7 RKSLIRRHNAQQ*TNTQSAR------NNKQINLNNIQDL 105 RK +R H A Q AR N+K +N+NN+ DL Sbjct: 1751 RKRYMRDHTAHHIAILQQARAQLLEFNSKNVNINNLSDL 1789 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,229,452 Number of Sequences: 219361 Number of extensions: 679368 Number of successful extensions: 1880 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1879 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)