Clone Name | rbart18b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | K1849_HUMAN (Q96JH8) Protein KIAA1849 | 30 | 2.2 | 2 | B3A2_RABIT (P48746) Anion exchange protein 2 (Non-erythroid band... | 29 | 3.7 | 3 | CD2_MOUSE (P08920) T-cell surface antigen CD2 precursor (T-cell ... | 28 | 6.4 | 4 | MDC1_MOUSE (Q5PSV9) Mediator of DNA damage checkpoint protein 1 | 28 | 8.3 |
---|
>K1849_HUMAN (Q96JH8) Protein KIAA1849| Length = 1073 Score = 30.0 bits (66), Expect = 2.2 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 6/63 (9%) Frame = +2 Query: 197 EASSPHEVVLQQPLRIRHHLLDAVERAKPLGPGRQQRRRSGVKQPHAAHGL------GRL 358 EA+ + + Q L +RH L RA P PGR SG QP G+ G L Sbjct: 786 EANCLDDSIYQHLLYVRHFLWGLRSRASPGSPGRP---GSGASQPVCPEGMHHVVLDGHL 842 Query: 359 EPP 367 E P Sbjct: 843 EAP 845
>B3A2_RABIT (P48746) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (B3RP) Length = 1237 Score = 29.3 bits (64), Expect = 3.7 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 260 DAVERAKPLGPGRQQRRRSGVKQPHAAHGLGRLEPPDEAA 379 DA R P GPGR+ RRR G A + E +E A Sbjct: 92 DARRRKTPQGPGRKPRRRPGASPTGATPTIEEGEEDEEEA 131
>CD2_MOUSE (P08920) T-cell surface antigen CD2 precursor (T-cell surface| antigen T11/Leu-5) (LFA-2) (LFA-3 receptor) (Lymphocyte antigen Ly-37) Length = 344 Score = 28.5 bits (62), Expect = 6.4 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 194 PEASSPHEVVLQQPLRIRHHLLDAVERAKPLGPGRQQRRRSGVKQP 331 P A++ + V LQ P HHL R PL PG + R K+P Sbjct: 263 PAAAAQNSVALQAPPPPGHHLQTPGHR--PLPPGHRTREHQQKKRP 306
>MDC1_MOUSE (Q5PSV9) Mediator of DNA damage checkpoint protein 1| Length = 1707 Score = 28.1 bits (61), Expect = 8.3 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 272 RAKPLGPGRQQR-RRSGVKQPHAAHGLGRLEPPDEAAEHDVHE 397 + PL PGRQQR R S P G EPPD V E Sbjct: 924 KGDPLSPGRQQRGRLSCQTTPAGKASRGDPEPPDHCLFSSVPE 966 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,666,110 Number of Sequences: 219361 Number of extensions: 703669 Number of successful extensions: 1738 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1737 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)