ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart18a10 |
|---|---|
| Clone Library Name | barley_pub |
>PIP26_ORYSA (Q7XLR1) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2.6) (OsPIP2.6) Length = 282 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF+GALAAAAYHQYILRAAAIKALG Sbjct: 250 PFIGALAAAAYHQYILRAAAIKALG 274
>PIP1_ATRCA (P42767) Aquaporin PIP-type| Length = 282 Score = 51.2 bits (121), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PFVGALAAAAYHQY+LRAAAIKALG Sbjct: 250 PFVGALAAAAYHQYVLRAAAIKALG 274
>PIP28_ARATH (Q9ZVX8) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 3b) (PIP3b) Length = 278 Score = 49.3 bits (116), Expect = 5e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKAL 396 PFVGALAAAAYHQYILRAAAIKAL Sbjct: 246 PFVGALAAAAYHQYILRAAAIKAL 269
>PIP27_ARATH (P93004) Aquaporin PIP2.7 (Plasma membrane intrinsic protein 3)| (Salt stress-induced major intrinsic protein) Length = 280 Score = 49.3 bits (116), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF+GALAAAAYHQYILRA+AIKALG Sbjct: 248 PFLGALAAAAYHQYILRASAIKALG 272
>PIP21_ORYSA (Q8H5N9) Probable aquaporin PIP2.1 (Plasma membrane intrinsic| protein 2a) (PIP2a) (OsPIP2.1) Length = 290 Score = 43.9 bits (102), Expect = 2e-04 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PFVGA AA YHQYILRA AIKALG Sbjct: 260 PFVGAAIAAFYHQYILRAGAIKALG 284
>PIP24_ARATH (Q9FF53) Probable aquaporin PIP2.4 (Plasma membrane intrinsic| protein 2.4) Length = 291 Score = 43.1 bits (100), Expect = 3e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 P +GA AAA YHQ+ILRAAAIKALG Sbjct: 255 PMIGAAAAAFYHQFILRAAAIKALG 279
>PIP25_ARATH (Q9SV31) Probable aquaporin PIP2.5 (Plasma membrane intrinsic| protein 2d) (PIP2d) Length = 286 Score = 40.4 bits (93), Expect = 0.002 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF GA AA YHQ++LRA AIKALG Sbjct: 254 PFAGAAIAAFYHQFVLRAGAIKALG 278
>PIP26_ARATH (Q9ZV07) Probable aquaporin PIP2.6 (Plasma membrane intrinsic| protein 2e) (PIP2e) Length = 289 Score = 38.9 bits (89), Expect = 0.007 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PFVGA AA YHQ++LRA A+KA G Sbjct: 254 PFVGAAIAAFYHQFVLRAGAMKAYG 278
>PIP23_ARATH (P30302) Aquaporin PIP2.3 (Plasma membrane intrinsic protein 2c)| (PIP2c) (TMP2C) (RD28-PIP) (Water stress-induced tonoplast intrinsic protein) (WSI-TIP) Length = 285 Score = 37.0 bits (84), Expect = 0.025 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF+GA AA YHQ++LRA+ K+LG Sbjct: 253 PFIGATIAAFYHQFVLRASGSKSLG 277
>PIP22_ARATH (P43287) Aquaporin PIP2.2 (Plasma membrane intrinsic protein 2b)| (PIP2b) (TMP2b) Length = 285 Score = 37.0 bits (84), Expect = 0.025 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF+GA AA YHQ++LRA+ K+LG Sbjct: 253 PFIGAAIAAFYHQFVLRASGSKSLG 277
>PIP21_ARATH (P43286) Aquaporin PIP2.1 (Plasma membrane intrinsic protein 2a)| (PIP2a) Length = 287 Score = 37.0 bits (84), Expect = 0.025 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKALG 393 PF+GA AA YHQ++LRA+ K+LG Sbjct: 255 PFIGAAIAAFYHQFVLRASGSKSLG 279
>PIP22_ORYSA (Q6K215) Probable aquaporin PIP2.2 (Plasma membrane intrinsic| protein 2.2) (OsPIP2.2) Length = 288 Score = 36.2 bits (82), Expect = 0.043 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIK 402 P +GA AAAYHQY+LRA+A K Sbjct: 259 PLIGAAIAAAYHQYVLRASAAK 280
>PIP23_ORYSA (Q7XUA6) Probable aquaporin PIP2.3 (Plasma membrane intrinsic| protein 2.3) (OsPIP2.3) Length = 290 Score = 36.2 bits (82), Expect = 0.043 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIK 402 P +GA AAAYHQY+LRA+A K Sbjct: 260 PLIGAAIAAAYHQYVLRASAAK 281
>PIP28_ORYSA (Q7Y1E6) Probable aquaporin PIP2.8 (Plasma membrane intrinsic| protein 2.8) (OsPIP2.8) Length = 280 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF GA AA YH YILR AA KA Sbjct: 247 PFAGAAAAMIYHHYILRGAAAKA 269
>PIP24_ORYSA (Q8GRT8) Aquaporin PIP2.4 (Plasma membrane intrinsic protein 2.4)| (OsPIP2.4) Length = 286 Score = 32.3 bits (72), Expect = 0.62 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAA 408 PF+GA AA YHQ ILRA+A Sbjct: 257 PFIGAAIAALYHQVILRASA 276
>PIP27_ORYSA (Q651D5) Probable aquaporin PIP2.7 (Plasma membrane intrinsic| protein 2.7) (OsPIP2.7) Length = 290 Score = 32.3 bits (72), Expect = 0.62 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKAL 396 P +GA AAAYH+ +LR A KAL Sbjct: 257 PVIGAFLAAAYHKLVLRGEAAKAL 280
>PIP25_ORYSA (Q8GRI8) Aquaporin PIP2.5 (Plasma membrane intrinsic protein 2.5)| (OsPIP2.5) Length = 283 Score = 32.0 bits (71), Expect = 0.80 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAA 408 PF+GA AA YHQ +LRA+A Sbjct: 254 PFIGAAIAALYHQIVLRASA 273
>PIP11_ORYSA (Q6EU94) Aquaporin PIP1.1 (Plasma membrane intrinsic protein 1a)| (PIP1a) (OsPIP1.1) (Water channel protein RWC1) (RWC-1) Length = 289 Score = 31.6 bits (70), Expect = 1.0 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PFVGA AA YHQ I+RA K+ Sbjct: 265 PFVGAALAAIYHQVIIRAIPFKS 287
>SMYD4_PONPY (Q5R5X9) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 329 YCHRCIKLLAGVLSCSGCS 385 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>SMYD4_HUMAN (Q8IYR2) SET and MYND domain-containing protein 4| Length = 804 Score = 30.8 bits (68), Expect = 1.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 329 YCHRCIKLLAGVLSCSGCS 385 YCHRC+K + C GCS Sbjct: 295 YCHRCLKHTLATVPCDGCS 313
>PIP12_ORYSA (Q7XSQ9) Probable aquaporin PIP1.2 (Plasma membrane intrinsic| protein 1.2) (OsPIP1.2) Length = 282 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF+GA AA YHQ ++RA K+ Sbjct: 258 PFIGAALAAIYHQVVIRAIPFKS 280
>PIP15_ARATH (Q8LAA6) Probable aquaporin PIP1.5 (Plasma membrane intrinsic| protein 1d) (PIP1d) Length = 287 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF+GA AA YHQ ++RA K+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKS 285
>PIP14_ARATH (Q39196) Probable aquaporin PIP1.4 (Plasma membrane intrinsic| protein 1.4) (Transmembrane protein C) (TMP-C) Length = 287 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF+GA AA YHQ ++RA K+ Sbjct: 263 PFIGAALAALYHQIVIRAIPFKS 285
>PIP13_ARATH (Q08733) Aquaporin PIP1.3 (Plasma membrane intrinsic protein 1c)| (PIP1c) (Transmembrane protein B) (TMP-B) Length = 286 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF+GA AA YHQ ++RA K+ Sbjct: 262 PFIGAALAALYHQLVIRAIPFKS 284
>PIP2_PEA (P25794) Probable aquaporin PIP-type 7a (Turgor-responsive protein| 7a) (Turgor-responsive protein 31) Length = 289 Score = 30.8 bits (68), Expect = 1.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -1 Query: 467 PFVGALAAAAYHQYILRAAAIKA 399 PF+GA AA YHQ ++RA K+ Sbjct: 266 PFIGAALAALYHQVVIRAIPFKS 288
>SMYD4_CHICK (Q5F3V0) SET and MYND domain-containing protein 4| Length = 742 Score = 30.4 bits (67), Expect = 2.3 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 329 YCHRCIKLLAGVLSCSGCS 385 YCH C+K L + C GCS Sbjct: 294 YCHHCLKQLLASIPCCGCS 312
>UBR1_CAEEL (P91133) Ubiquitin-protein ligase E3 component N-recognin (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha) Length = 1927 Score = 29.6 bits (65), Expect = 4.0 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 387 PEQPEQLSTPANNLMQRWQYCSSCPSGAS*PHKRTGFVLAVLLLHRAHP 241 P +P+ TP + L+ S P+ A PH T F V L + A P Sbjct: 1560 PPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLVQLFNPAGP 1608
>SMYD4_MOUSE (Q8BTK5) SET and MYND domain-containing protein 4| Length = 799 Score = 28.5 bits (62), Expect = 8.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 329 YCHRCIKLLAGVLSCSGCS 385 YCHRC+K + C CS Sbjct: 295 YCHRCLKHTLATVPCGSCS 313
>TELT_MOUSE (O70548) Telethonin (Titin cap protein)| Length = 167 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +2 Query: 224 QTLNEAGWARWRSSTANTKPVRLCG*LAPDGHEEQYCHR 340 Q EA WA W+ T +T+P C D + HR Sbjct: 15 QERREAFWAEWKDLTLSTRPEEGCSLHEEDTQRHETYHR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,741,291 Number of Sequences: 219361 Number of extensions: 1079071 Number of successful extensions: 2671 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 2574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2671 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
