Clone Name | rbart18a01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YWFO_BACSU (P39651) Hypothetical protein ywfO | 29 | 5.1 | 2 | FOXF2_HUMAN (Q12947) Forkhead box protein F2 (Forkhead-related p... | 29 | 6.7 | 3 | FOXF1_HUMAN (Q12946) Forkhead box protein F1 (Forkhead-related p... | 29 | 6.7 | 4 | FOXF1_MOUSE (Q61080) Forkhead box protein F1 (Forkhead-related p... | 29 | 6.7 |
---|
>YWFO_BACSU (P39651) Hypothetical protein ywfO| Length = 433 Score = 29.3 bits (64), Expect = 5.1 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 99 HGFVYFYSMKPSTL*CKD*LKRDESVCSYYF 7 H V+FYS+ L +D +K DES+ YYF Sbjct: 264 HAPVHFYSIFEGKLTLEDYVKLDESIILYYF 294
>FOXF2_HUMAN (Q12947) Forkhead box protein F2 (Forkhead-related protein FKHL6)| (Forkhead-related transcription factor 2) (FREAC-2) (Forkhead-related activator 2) Length = 444 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 145 ASKRSFQKGNKKRERRGAHRSCSALRP 225 AS+ F++G+ +R RG R C AL+P Sbjct: 179 ASEFMFEEGSFRRRPRGFRRKCQALKP 205
>FOXF1_HUMAN (Q12946) Forkhead box protein F1 (Forkhead-related protein FKHL5)| (Forkhead-related transcription factor 1) (FREAC-1) (Forkhead-related activator 1) Length = 354 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 145 ASKRSFQKGNKKRERRGAHRSCSALRP 225 AS+ F++G+ +R RG R C AL+P Sbjct: 102 ASEFMFEEGSFRRRPRGFRRKCQALKP 128
>FOXF1_MOUSE (Q61080) Forkhead box protein F1 (Forkhead-related protein FKHL5)| (Forkhead-related transcription factor 1) (FREAC-1) (Hepatocyte nuclear factor 3 forkhead homolog 8) (HFH-8) Length = 353 Score = 28.9 bits (63), Expect = 6.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 145 ASKRSFQKGNKKRERRGAHRSCSALRP 225 AS+ F++G+ +R RG R C AL+P Sbjct: 102 ASEFMFEEGSFRRRPRGFRRKCQALKP 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,592,696 Number of Sequences: 219361 Number of extensions: 830033 Number of successful extensions: 2025 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2023 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)