| Clone Name | rbart17h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUP5_MOUSE (P11591) Major urinary protein 5 precursor (MUP 5) | 29 | 6.8 | 2 | ARO9_YEAST (P38840) Aromatic amino acid aminotransferase 2 (EC 2... | 29 | 6.8 |
|---|
>MUP5_MOUSE (P11591) Major urinary protein 5 precursor (MUP 5)| Length = 180 Score = 28.9 bits (63), Expect = 6.8 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 188 ELLLRLCNSLDTVCLHLDEAALWRASWN 105 +LLL LC L VC+H +EA+ R ++N Sbjct: 2 KLLLLLCLELTLVCVHAEEASSERQNFN 29
>ARO9_YEAST (P38840) Aromatic amino acid aminotransferase 2 (EC 2.6.1.-)| (Aromatic amino acid aminotransferase II) Length = 513 Score = 28.9 bits (63), Expect = 6.8 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -3 Query: 148 ASTWTRPPSGAHLGILYGWTYGV----LSSELFITETLLNAW*MWIFRTA 11 A TR PSG I+Y + LSS L + E + W WI + A Sbjct: 342 ADITTRAPSGTSQAIVYSTIKAMAESNLSSSLSMKEAMFEGWIRWIMQIA 391 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,730,130 Number of Sequences: 219361 Number of extensions: 870200 Number of successful extensions: 2319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2319 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)