| Clone Name | rbart17g09 |
|---|---|
| Clone Library Name | barley_pub |
>C56D1_HUMAN (Q8N8Q1) Cytochrome b561 domain-containing protein 1| Length = 229 Score = 29.3 bits (64), Expect = 4.1 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 62 SLFAWEKGMMSLNLCLCGSAAPRMILPKMK*TRRYFFYQIKARKR 196 SLF+W M+L CLC + A + P+ +FF KAR R Sbjct: 50 SLFSWHPVFMALAFCLCMAEAILLFSPEHS---LFFFCSRKARIR 91
>SRYA_DROME (P07666) Serendipity locus protein alpha| Length = 530 Score = 29.3 bits (64), Expect = 4.1 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 274 PSSSSSLHQAYIVQLHFGANVLVIRDYTYPV 366 P S+SS H A ++Q HF +L+ R+ + + Sbjct: 323 PESTSSAHHAEVLQEHFNQELLIFRNVIHEI 353
>AMDY_YEAST (P22580) Probable amidase (EC 3.5.1.4)| Length = 549 Score = 28.9 bits (63), Expect = 5.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Frame = +1 Query: 247 CPPW-----CCAFH-PSSSSSLHQAYIVQLHFGANVL 339 C PW C +H SS+S LH Y+V + +G V+ Sbjct: 293 CQPWVQDVKCIPYHFDSSTSKLHDNYVVGIWYGDGVI 329
>SRYA_DROPS (Q07964) Serendipity locus protein alpha| Length = 549 Score = 28.5 bits (62), Expect = 7.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 262 CAFHPSSSSSLHQAYIVQLHFGANVLVIRDYTYPVETSKKKIH 390 C SS+LH A I++ HF +L+ R+ + + S+ ++ Sbjct: 332 CIVPALQSSALHHADILEHHFNGEMLIFRNLIHDIIDSRSLVN 374
>ATX2L_HUMAN (Q8WWM7) Ataxin-2-like protein (Ataxin-2 domain protein)| (Ataxin-2-related protein) Length = 1075 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 301 AYIVQLHFGANVLVIRDYTYPVETSKKKIHGKQEATAGT 417 +YI Q+H G V + Y YPV S GK G+ Sbjct: 712 SYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGS 750
>ATX2L_MOUSE (Q7TQH0) Ataxin-2-like protein| Length = 1049 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 301 AYIVQLHFGANVLVIRDYTYPVETSKKKIHGKQEATAGT 417 +YI Q+H G V + Y YPV S GK G+ Sbjct: 715 SYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGS 753
>URE1_YERPS (P52313) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 572 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 275 GWNAQHHGGQCLRALRHVLIMSMCVPLSFSL*SDKRNTFWFISSWEGSFLGQHCHT 108 G+ G ALRH L M+ V + S+ +D N ++ +F G+ HT Sbjct: 220 GYKVHEDWGATANALRHALRMADEVDIQVSVHTDSLNECGYVEDTIDAFEGRTIHT 275
>URE1_YERPE (Q9ZFR9) Urease alpha subunit (EC 3.5.1.5) (Urea amidohydrolase| alpha subunit) Length = 572 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 275 GWNAQHHGGQCLRALRHVLIMSMCVPLSFSL*SDKRNTFWFISSWEGSFLGQHCHT 108 G+ G ALRH L M+ V + S+ +D N ++ +F G+ HT Sbjct: 220 GYKVHEDWGATANALRHALRMADEVDIQVSVHTDSLNECGYVEDTIDAFEGRTIHT 275
>SHAN1_HUMAN (Q9Y566) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2161 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 163 PSGLFHLGKDHSWGSTATQTQIKAHHPFLPSKKR 62 P GL LGK G AT++ HH PS +R Sbjct: 841 PGGLASLGKHRPKGFFATESSFDPHHRAQPSYER 874 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,522,777 Number of Sequences: 219361 Number of extensions: 1300635 Number of successful extensions: 2768 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2768 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)