ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbart17g01 |
|---|---|
| Clone Library Name | barley_pub |
>IAA30_ORYSA (P0C132) Auxin-responsive protein IAA30 (Indoleacetic acid-induced| protein 30) Length = 277 Score = 107 bits (268), Expect = 9e-24 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 PTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRAMEKCK+RS Sbjct: 227 PTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277
>IAA16_ARATH (O24407) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 236 Score = 105 bits (262), Expect = 4e-23 Identities = 47/51 (92%), Positives = 50/51 (98%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 PTYEDKDGDWMLVGDVPWEMFV SCKR+RIMKGSEAIGLAPRA+EKCK+RS Sbjct: 186 PTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236
>IAA11_ORYSA (Q75GK0) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 233 Score = 103 bits (258), Expect = 1e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKS 280 PTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEAIGLAPRA+EKCKS Sbjct: 185 PTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKS 233
>IAA7_ARATH (Q38825) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) (Auxin resistant 2) Length = 243 Score = 101 bits (251), Expect = 8e-22 Identities = 47/52 (90%), Positives = 50/52 (96%), Gaps = 1/52 (1%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEK-CKSRS 274 P+YEDKDGDWMLVGDVPWEMFV SCKRLRIMKGSEA+GLAPRAMEK CK+RS Sbjct: 192 PSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS 243
>IAA17_ARATH (P93830) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) (Auxin response 3) Length = 229 Score = 100 bits (249), Expect = 1e-21 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 P+YEDKDGDWMLVGDVPW MFV +CKRLR+MKGS+AIGLAPRAMEKCKSR+ Sbjct: 179 PSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA 229
>IAA14_ARATH (Q38832) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) (SOLITARY-ROOT protein) Length = 228 Score = 99.8 bits (247), Expect = 2e-21 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 P+YEDKDGDWMLVGDVPW MFV SCKRLRIMKGSEAIGLAPRAMEK K+RS Sbjct: 178 PSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228
>AUX28_SOYBN (P13089) Auxin-induced protein AUX28| Length = 243 Score = 99.0 bits (245), Expect = 4e-21 Identities = 47/53 (88%), Positives = 48/53 (90%), Gaps = 2/53 (3%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAI--GLAPRAMEKCKSRS 274 PTYEDKDGDWMLVGDVPWEMFV SCKRLRIMKG EAI GLAPRAM KCK+RS Sbjct: 191 PTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPRAMAKCKNRS 243
>IAA27_ARATH (Q9ZSY8) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) (Auxin-induced protein 27) (Phytochrome-associated protein 2) Length = 305 Score = 96.7 bits (239), Expect = 2e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 TYEDKD DWMLVGDVPWEMF+ SCK+LRIMK SEAIGLAPR MEKC+SR+ Sbjct: 256 TYEDKDSDWMLVGDVPWEMFICSCKKLRIMKSSEAIGLAPRVMEKCRSRN 305
>IAA13_ORYSA (Q7Y1Y5) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 236 Score = 95.1 bits (235), Expect = 6e-20 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 TYEDKDGDWMLVGDVPW+MFV SCKRLRIMKGSEAIGLAPRA +K K++S Sbjct: 187 TYEDKDGDWMLVGDVPWQMFVESCKRLRIMKGSEAIGLAPRAKDKYKNKS 236
>IAA17_ORYSA (Q75GB1) Auxin-responsive protein IAA17 (Indoleacetic acid-induced| protein 17) Length = 257 Score = 93.2 bits (230), Expect = 2e-19 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 TYEDKDGDWMLVGDVPWEMF SC+RLRIMKGS+AIGLAPRA++K K+R+ Sbjct: 208 TYEDKDGDWMLVGDVPWEMFANSCRRLRIMKGSDAIGLAPRAVDKSKNRN 257
>IAA3_ORYSA (Q5NB25) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) Length = 263 Score = 92.8 bits (229), Expect = 3e-19 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 TYEDKDGDWMLVGDVPWEMF SC+RLRIMKGS+AIGLAPRA EK K+R+ Sbjct: 214 TYEDKDGDWMLVGDVPWEMFTDSCRRLRIMKGSDAIGLAPRAGEKSKNRN 263
>IAA21_ORYSA (Q5Z749) Auxin-responsive protein IAA21 (Indoleacetic acid-induced| protein 21) Length = 266 Score = 87.0 bits (214), Expect = 2e-17 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSRS 274 TYEDKD DWMLVGDVPW MF SC+RLRIMKGS+A+GLAPRA +K K+R+ Sbjct: 217 TYEDKDEDWMLVGDVPWRMFTDSCRRLRIMKGSDAVGLAPRATDKSKNRN 266
>IAA9_ARATH (Q38827) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 338 Score = 85.9 bits (211), Expect = 4e-17 Identities = 40/52 (76%), Positives = 45/52 (86%), Gaps = 2/52 (3%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL--APRAMEKCKSRS 274 TYEDKDGDWMLVGDVPWEMF+ CK+L+IMKG +AIGL APRAMEK K R+ Sbjct: 287 TYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMRA 338
>IAA8_ARATH (Q38826) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 321 Score = 84.0 bits (206), Expect = 1e-16 Identities = 35/49 (71%), Positives = 45/49 (91%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKSR 277 TYEDKDGDWMLVGDVPWE+F +C++L+IMKGS++IGLAP A+EK K++ Sbjct: 270 TYEDKDGDWMLVGDVPWEIFTETCQKLKIMKGSDSIGLAPGAVEKSKNK 318
>IAA1_ORYSA (Q5VRD1) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 199 Score = 83.2 bits (204), Expect = 2e-16 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAME 292 PTYEDKDGDWMLVGDVPW+MFV +C+RLR+MK SEA+ LAPRA + Sbjct: 155 PTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLAPRAAQ 199
>IAA23_ORYSA (Q69VE0) Auxin-responsive protein IAA23 (Indoleacetic acid-induced| protein 23) Length = 193 Score = 82.0 bits (201), Expect = 5e-16 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPR 301 PTYEDKDGDWMLVGDVPW+MFV SCKR+R+MK SEA+ L+PR Sbjct: 148 PTYEDKDGDWMLVGDVPWKMFVESCKRIRLMKSSEAVNLSPR 189
>IAA4_ARATH (P33077) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) (Auxin-induced protein AUX2-11) Length = 186 Score = 81.6 bits (200), Expect = 7e-16 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPWEMFV+SCKRLRIMKGSE GL Sbjct: 143 PTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGL 181
>AX22B_PHAAU (P32294) Auxin-induced protein 22B (Indole-3-acetic acid-induced| protein ARG4) Length = 196 Score = 81.6 bits (200), Expect = 7e-16 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPW+MFV SCKRLRIMKGSEA GL Sbjct: 154 PTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGL 192
>IAA15_ORYSA (Q6AT10) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 212 Score = 81.6 bits (200), Expect = 7e-16 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRA 298 PTYEDKDGDWMLVGDVPW+MFV +C+RLR+MK SEA+ LAPR+ Sbjct: 169 PTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLAPRS 211
>AX22D_PHAAU (O24542) Auxin-induced protein 22D (Indole-3-acetic acid-induced| protein ARG13) Length = 193 Score = 81.3 bits (199), Expect = 9e-16 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPW MFV+SCKRLRIMKGSEA GL Sbjct: 152 PTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGSEAKGL 190
>IAA3_ARATH (Q38822) Auxin-responsive protein IAA3 (Indoleacetic acid-induced| protein 3) (Short hypocotyl) (Suppressor of HY2) Length = 189 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWML+GDVPWEMF+ +CKRLRIMKGSEA GL Sbjct: 147 PTYEDKDGDWMLIGDVPWEMFICTCKRLRIMKGSEAKGL 185
>IAA4_PEA (P49679) Auxin-induced protein IAA4| Length = 189 Score = 80.5 bits (197), Expect = 2e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPW+MFV SCKRLRIMKG+EA GL Sbjct: 147 PTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGTEAKGL 185
>AX22E_PHAAU (O24543) Auxin-induced protein 22E (Indole-3-acetic acid-induced| protein ARG14) Length = 203 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPW MFV+SCKRLRI+KGSEA GL Sbjct: 162 PTYEDKDGDWMLVGDVPWNMFVSSCKRLRIIKGSEAKGL 200
>IAA19_ORYSA (Q6AT33) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) Length = 281 Score = 77.8 bits (190), Expect = 1e-14 Identities = 30/45 (66%), Positives = 41/45 (91%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEK 289 TYEDKD DWMLVGD+PW++F SC++LRIM+GS+A G+APR++E+ Sbjct: 232 TYEDKDADWMLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPRSLEQ 276
>IAA2_ARATH (P49678) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 174 Score = 76.3 bits (186), Expect = 3e-14 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 PTYEDKDGDWMLVGDVPW+MF +SCKRLRIMKGS+A L Sbjct: 132 PTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSDAPAL 170
>IAA1_ARATH (P49677) Auxin-responsive protein IAA1 (Indoleacetic acid-induced| protein 1) Length = 168 Score = 74.3 bits (181), Expect = 1e-13 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA 319 PTYEDKDGDWMLVGDVPW+MF +SC++LRIMKGSEA Sbjct: 129 PTYEDKDGDWMLVGDVPWDMFSSSCQKLRIMKGSEA 164
>AUX22_SOYBN (P13088) Auxin-induced protein AUX22| Length = 195 Score = 74.3 bits (181), Expect = 1e-13 Identities = 35/48 (72%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA--IGLAPRAMEK 289 P YEDKDGDWMLVGDVPWEMF+ SCKRLRIMK S+A GL P+ K Sbjct: 140 PIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKKSDAKGFGLQPKGSLK 187
>IAA12_ARATH (Q38830) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) (BODENLOS protein) Length = 239 Score = 74.3 bits (181), Expect = 1e-13 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEK 289 TYEDK+GDWMLVGDVPW MF+ S KRLRIM SEA GLAPR E+ Sbjct: 186 TYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQ 230
>IAA6_PEA (P49680) Auxin-induced protein IAA6| Length = 179 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIG 313 P YEDKDGDWMLVGDVPWEMF+ SCKRLRIMK S+A G Sbjct: 129 PIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKG 166
>IAA5_ORYSA (Q59AF3) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) Length = 271 Score = 73.9 bits (180), Expect = 1e-13 Identities = 28/45 (62%), Positives = 40/45 (88%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEK 289 TYEDKD DWMLVGD+PW++F C++L+IM+GS+A G+APR++E+ Sbjct: 222 TYEDKDADWMLVGDLPWDLFTTICRKLKIMRGSDAAGIAPRSIEQ 266
>AX22A_PHAAU (P32293) Auxin-induced protein 22A (Indole-3-acetic acid-induced| protein ARG3) Length = 194 Score = 73.2 bits (178), Expect = 2e-13 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA--IGLAPRAMEK 289 P YEDKDGDWMLVGDVPWEMF+ SCKRLRIMK ++A GL P+ K Sbjct: 139 PIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKRADAKGFGLQPKGSLK 186
>IAA13_ARATH (Q38831) Auxin-responsive protein IAA13 (Indoleacetic acid-induced| protein 13) Length = 247 Score = 72.4 bits (176), Expect = 4e-13 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAME 292 TYEDK+GDWMLVGDVPW MF+ S KRLR+MK SEA GLA R E Sbjct: 194 TYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQE 237
>AX22C_PHAAU (O24541) Auxin-induced protein 22C (Indole-3-acetic acid-induced| protein ARG12) Length = 188 Score = 71.6 bits (174), Expect = 7e-13 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIG 313 P YEDKDGDWMLVGDVPWEMF SCKRLRIMK S+A G Sbjct: 133 PIYEDKDGDWMLVGDVPWEMFRESCKRLRIMKRSDAKG 170
>IAA10_ORYSA (Q59AA1) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 281 Score = 71.6 bits (174), Expect = 7e-13 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPR 301 TYED+DGDWMLVGDVPWEMFV+S KRLRIM+ S+A GL R Sbjct: 226 TYEDRDGDWMLVGDVPWEMFVSSVKRLRIMRTSDANGLGQR 266
>IAA26_ORYSA (Q652A1) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) Length = 140 Score = 70.9 bits (172), Expect = 1e-12 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRA 298 YED DGDWMLVGDVPWEMFV+SCKR+R+M+ EA GL+ A Sbjct: 100 YEDGDGDWMLVGDVPWEMFVSSCKRMRVMRACEARGLSSNA 140
>IAA31_ORYSA (P0C133) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 197 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 TYEDKDGD MLVGDVP+EMF+++CKRLRIMKGSEA GL Sbjct: 155 TYEDKDGDLMLVGDVPFEMFISTCKRLRIMKGSEARGL 192
>IAA19_ARATH (O24409) Auxin-responsive protein IAA19 (Indoleacetic acid-induced| protein 19) (MASSUGU2 protein) Length = 197 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA--IGLAPRAMEK 289 YEDKDGDWML GDVPW MF+ SCKRLRIMK S+A GL PR +++ Sbjct: 152 YEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE 197
>IAA24_ORYSA (Q6ZL57) Auxin-responsive protein IAA24 (Indoleacetic acid-induced| protein 24) Length = 219 Score = 69.3 bits (168), Expect = 4e-12 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA 319 YEDKDGD MLVGDVPWEMF++SCK+LRIMKGSEA Sbjct: 185 YEDKDGDLMLVGDVPWEMFISSCKKLRIMKGSEA 218
>IAA5_ARATH (P33078) Auxin-responsive protein IAA5 (Indoleacetic acid-induced| protein 5) (Auxin-induced protein AUX2-27) Length = 163 Score = 68.6 bits (166), Expect = 6e-12 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 426 PTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGS 325 P YEDKDGDWML GDVPWEMF+ SCKRLRIMK S Sbjct: 126 PIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRS 159
>IAA15_ARATH (Q9C966) Auxin-responsive protein IAA15 (Indoleacetic acid-induced| protein 15) Length = 179 Score = 67.4 bits (163), Expect = 1e-11 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 TYEDKDGD MLVGDVPW MFV SCKR+R+MK +AIGL Sbjct: 142 TYEDKDGDLMLVGDVPWMMFVESCKRMRLMKTGDAIGL 179
>IAA11_ARATH (Q38829) Auxin-responsive protein IAA11 (Indoleacetic acid-induced| protein 11) Length = 246 Score = 67.4 bits (163), Expect = 1e-11 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLA 307 TYEDK+GDWMLVGDVPW MF+ S +RLRIMK SEA G A Sbjct: 204 TYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSEATGKA 242
>IAA12_ORYSA (Q75GK1) Auxin-responsive protein IAA12 (Indoleacetic acid-induced| protein 12) Length = 226 Score = 65.5 bits (158), Expect = 5e-11 Identities = 31/45 (68%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL-APRAME 292 TY+DKDGD MLVGDVP++MF ++CK+LRIMK SEA GL +PR M+ Sbjct: 181 TYQDKDGDLMLVGDVPFDMFTSTCKKLRIMKRSEATGLGSPRQMK 225
>IAA14_ORYSA (Q7Y1H8) Auxin-responsive protein IAA14 (Indoleacetic acid-induced| protein 14) Length = 195 Score = 65.5 bits (158), Expect = 5e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEA 319 YEDKDGD ML GDVPW+MF++SCK+LRIM+GSEA Sbjct: 161 YEDKDGDLMLAGDVPWDMFISSCKKLRIMRGSEA 194
>IAA6_ARATH (Q38824) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 189 Score = 64.7 bits (156), Expect = 9e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIG 313 YEDKD DWMLVGDVPW+MF SCKRLRI+K S+A G Sbjct: 148 YEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATG 183
>IAA10_ARATH (Q38828) Auxin-responsive protein IAA10 (Indoleacetic acid-induced| protein 10) Length = 261 Score = 62.4 bits (150), Expect = 4e-10 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 TY+DKDGDWMLVGDVPW+MF+ S RLRIMK S G+ Sbjct: 222 TYQDKDGDWMLVGDVPWQMFLGSVTRLRIMKTSIGAGV 259
>IAA26_ARATH (Q8LAL2) Auxin-responsive protein IAA26 (Indoleacetic acid-induced| protein 26) (Phytochrome-associated protein 1) Length = 269 Score = 58.2 bits (139), Expect = 8e-09 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 TYED +GD MLVGDVPW+MFV+S KRLR++K SE Sbjct: 219 TYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSE 252
>IAA28_ARATH (Q9XFM0) Auxin-responsive protein IAA28 (Indoleacetic acid-induced| protein 28) Length = 175 Score = 58.2 bits (139), Expect = 8e-09 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPR 301 YED +GD +LVGDVPWEMFV++ KRL ++K S A L+PR Sbjct: 131 YEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPR 170
>IAA18_ARATH (O24408) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 267 Score = 57.4 bits (137), Expect = 1e-08 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 TYED +GD MLVGDVPW+MFV+S KRLR++K SE Sbjct: 217 TYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSE 250
>IAA4_ORYSA (Q59AF4) Auxin-responsive protein IAA4 (Indoleacetic acid-induced| protein 4) Length = 203 Score = 57.4 bits (137), Expect = 1e-08 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 TYED+DGDWM+VGDVPWE+F++S K+LRI + Sbjct: 169 TYEDQDGDWMMVGDVPWELFLSSVKKLRIAR 199
>IAA8_ORYSA (Q6Z5M0) Auxin-responsive protein IAA8 (Indoleacetic acid-induced| protein 8) Length = 205 Score = 55.8 bits (133), Expect = 4e-08 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 TYED++GDWM+ GDVPWE+F+ S KRLRI + + Sbjct: 166 TYEDQEGDWMMAGDVPWELFLTSVKRLRIARADD 199
>IAA31_ARATH (Q8H174) Auxin-responsive protein IAA31 (Indoleacetic acid-induced| protein 31) Length = 158 Score = 55.5 bits (132), Expect = 5e-08 Identities = 20/31 (64%), Positives = 28/31 (90%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 TYEDKDGDWM+VGD+PW+MF+ + +RL+I + Sbjct: 124 TYEDKDGDWMMVGDIPWDMFLETVRRLKITR 154
>IAA30_ARATH (Q9M1R4) Putative auxin-responsive protein IAA30 (Putative| indoleacetic acid-induced protein 30) Length = 172 Score = 55.1 bits (131), Expect = 7e-08 Identities = 21/31 (67%), Positives = 28/31 (90%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 TY DK+GDWM+VGDVPWEMF++S +RL+I + Sbjct: 138 TYADKEGDWMMVGDVPWEMFLSSVRRLKISR 168
>IAA2_ORYSA (Q9LG86) Auxin-responsive protein IAA2 (Indoleacetic acid-induced| protein 2) Length = 238 Score = 55.1 bits (131), Expect = 7e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 YED +GD MLVGDVPW+MF+A+ KRLR++K S+ Sbjct: 186 YEDDEGDRMLVGDVPWQMFIATAKRLRVLKSSD 218
>IAA20_ARATH (O24410) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 175 Score = 54.3 bits (129), Expect = 1e-07 Identities = 20/33 (60%), Positives = 29/33 (87%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMKGS 325 TY DK+GDWM+VGDVPWEMF+++ +RL+I + + Sbjct: 140 TYADKEGDWMMVGDVPWEMFLSTVRRLKISRAN 172
>IAA9_ORYSA (Q6K846) Auxin-responsive protein IAA9 (Indoleacetic acid-induced| protein 9) Length = 182 Score = 53.1 bits (126), Expect = 3e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIM 334 TYED DGDWMLVGDVPW+ F S KRL+I+ Sbjct: 152 TYEDGDGDWMLVGDVPWDDFARSVKRLKIL 181
>IAA6_ORYSA (Q8LQ74) Auxin-responsive protein IAA6 (Indoleacetic acid-induced| protein 6) Length = 335 Score = 52.8 bits (125), Expect = 3e-07 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 YED +GD MLVGDVPW++FV++ KRLR+++ SE Sbjct: 291 YEDSEGDRMLVGDVPWKVFVSTAKRLRVLRSSE 323
>IAA16_ORYSA (P0C127) Auxin-responsive protein IAA16 (Indoleacetic acid-induced| protein 16) Length = 228 Score = 52.4 bits (124), Expect = 4e-07 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 YED +GD MLVGDVPW MF+A+ +RLR+++ S+ Sbjct: 179 YEDDEGDQMLVGDVPWNMFIAAARRLRVLRSSD 211
>IAA18_ORYSA (Q5W670) Auxin-responsive protein IAA18 (Indoleacetic acid-induced| protein 18) Length = 327 Score = 52.4 bits (124), Expect = 4e-07 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 YED DGD ML GD+PW++FV++ KRLR+M+ SE Sbjct: 283 YEDNDGDRMLAGDIPWKVFVSTVKRLRVMRRSE 315
>IAA20_ORYSA (Q5VRR0) Auxin-responsive protein IAA20 (Indoleacetic acid-induced| protein 20) Length = 183 Score = 51.2 bits (121), Expect = 1e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIM 334 TYED +GDWM VGDVPWE F S KRL+I+ Sbjct: 153 TYEDGEGDWMQVGDVPWEAFAKSVKRLKIL 182
>IAA7_ORYSA (Q6H543) Auxin-responsive protein IAA7 (Indoleacetic acid-induced| protein 7) Length = 300 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 YED +GD +LVGDVPW MFV+S KRLR++K S+ Sbjct: 251 YEDYEGDKVLVGDVPWGMFVSSVKRLRVLKTSD 283
>IAA27_ORYSA (P0C129) Auxin-responsive protein IAA27 (Indoleacetic acid-induced| protein 27) Length = 143 Score = 49.3 bits (116), Expect = 4e-06 Identities = 26/43 (60%), Positives = 29/43 (67%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAME 292 YED +GD MLVGDVPWE+F+AS KRL I K APR E Sbjct: 90 YEDFEGDRMLVGDVPWELFLASAKRLYIAKNP-----APRNKE 127
>IAA25_ORYSA (P0C128) Auxin-responsive protein IAA25 (Indoleacetic acid-induced| protein 25) Length = 246 Score = 48.9 bits (115), Expect = 5e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRI 337 YED +GD MLVGDVPWE+F+AS KRL I Sbjct: 208 YEDNEGDRMLVGDVPWELFIASVKRLYI 235
>IAA32_ARATH (Q8RYC6) Auxin-responsive protein IAA32 (Indoleacetic acid-induced| protein 32) Length = 191 Score = 42.7 bits (99), Expect = 4e-04 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAI 316 Y D++G W VGDVPW+ FV S R+RI + ++A+ Sbjct: 154 YRDREGIWRNVGDVPWKEFVESVDRMRIARRNDAL 188
>IAA34_ARATH (Q9C5X0) Auxin-responsive protein IAA34 (Indoleacetic acid-induced| protein 34) Length = 185 Score = 41.6 bits (96), Expect = 8e-04 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAI 316 Y D++G W GDVPW F+ S +RLRI + ++A+ Sbjct: 148 YRDEEGLWRNAGDVPWNEFIESVERLRITRRNDAV 182
>IAA29_ARATH (Q93WC4) Auxin-responsive protein IAA29 (Indoleacetic acid-induced| protein 29) Length = 251 Score = 39.3 bits (90), Expect = 0.004 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -1 Query: 423 TYEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 T++ K+GDW+L GDV W++F S R+ I++ Sbjct: 210 TFQGKEGDWLLRGDVTWKIFAESVHRISIIR 240
>ARFE_ARATH (P93024) Auxin response factor 5 (Transcription factor MONOPTEROS)| (Auxin-responsive protein IAA24) Length = 902 Score = 36.2 bits (82), Expect = 0.033 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKS 280 Y D + D +LVGD PWE FV + +RI+ +E ++ M+ S Sbjct: 845 YVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNS 891
>IAA33_ARATH (Q9FKM7) Putative auxin-responsive protein IAA33 (Putative| indoleacetic acid-induced protein 33) Length = 171 Score = 35.4 bits (80), Expect = 0.056 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIM 334 YED + D +L GD+ W+ FV KR+RI+ Sbjct: 130 YEDMENDLLLAGDLTWKDFVRVAKRIRIL 158
>IAA29_ORYSA (P0C131) Putative auxin-responsive protein IAA29 (Indoleacetic| acid-induced protein 29) Length = 171 Score = 35.0 bits (79), Expect = 0.074 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 Y+D DG +GDVPWE+F + K++ I+ + Sbjct: 84 YDDMDGVRYFLGDVPWEVFTTTVKKIYIVPAEQ 116
>IAA22_ORYSA (Q69TU6) Auxin-responsive protein IAA22 (Indoleacetic acid-induced| protein 22) Length = 265 Score = 34.7 bits (78), Expect = 0.096 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWE 370 YED +GD MLVGDVPW+ Sbjct: 156 YEDNEGDRMLVGDVPWD 172
>ARFG_ARATH (P93022) Auxin response factor 7 (Non-phototropic hypocotyl 4)| (Protein BIPOSTO) (Auxin-responsive protein IAA21/IAA23/IAA25) Length = 1164 Score = 34.3 bits (77), Expect = 0.13 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 Y D + D +LVGD PWE FV + ++I+ +E Sbjct: 1089 YVDHENDILLVGDDPWEEFVNCVQSIKILSSAE 1121
>ARFI_ARATH (Q9XED8) Auxin response factor 9| Length = 638 Score = 34.3 bits (77), Expect = 0.13 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAP 304 + D +GD MLVGD PW F KR+ I E + P Sbjct: 574 FTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKMTP 612
>ARFS_ARATH (Q8RYC8) Auxin response factor 19 (Auxin-responsive protein IAA22)| Length = 1086 Score = 33.9 bits (76), Expect = 0.16 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 Y D + D +LVGD PWE FV + ++I+ E Sbjct: 1010 YTDHENDILLVGDDPWEEFVNCVQNIKILSSVE 1042
>ARFB_ARATH (Q94JM3) Auxin response factor 2 (ARF1-binding protein) (ARF1-BP)| Length = 859 Score = 33.9 bits (76), Expect = 0.16 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKS 280 Y D++ D MLVGD PW+ F +++ I E + P + C+S Sbjct: 785 YTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEVRKMNPGTL-SCRS 830
>IAA28_ORYSA (P0C130) Putative auxin-responsive protein IAA28 (Indoleacetic| acid-induced protein 28) Length = 162 Score = 33.9 bits (76), Expect = 0.16 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 Y+D +G L+G+VPWE+F + KR+ I+ + Sbjct: 88 YDDMNGVRYLLGEVPWEVFTITVKRIYIVPAEQ 120
>ARFF_ARATH (Q9ZTX8) Auxin response factor 6| Length = 933 Score = 33.5 bits (75), Expect = 0.21 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAMEKCKS 280 + D++ D +L+GD PW FV+S ++I+ E + R +E S Sbjct: 846 FVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNS 892
>ARFK_ARATH (Q9ZPY6) Auxin response factor 11| Length = 601 Score = 33.1 bits (74), Expect = 0.28 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 + D +GD MLVGD PW F K+L I E Sbjct: 541 FTDDEGDRMLVGDDPWNEFCKMAKKLFIYPSDE 573
>ARFA_ARATH (Q8L7G0) Auxin response factor 1| Length = 665 Score = 32.7 bits (73), Expect = 0.37 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPR 301 Y D + D M+VGD PW F +++ I E L+P+ Sbjct: 594 YTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPK 633
>ARFR_ARATH (Q9C5W9) Auxin response factor 18| Length = 602 Score = 32.0 bits (71), Expect = 0.62 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSE 322 + D +GD ML GD PW F K++ I E Sbjct: 540 FTDDEGDMMLAGDDPWNEFCKMAKKIFIYSSDE 572
>ARFV_ARATH (Q9C8N7) Putative auxin response factor 22| Length = 598 Score = 31.6 bits (70), Expect = 0.81 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 + D D D MLVGD PW F K++ I K Sbjct: 560 FTDSDDDKMLVGDDPWPEFCNMVKKILIFK 589
>ARFH_ARATH (Q9FGV1) Auxin response factor 8| Length = 811 Score = 30.8 bits (68), Expect = 1.4 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIM 334 + DK+ D +L+GD PWE FV + ++I+ Sbjct: 757 FVDKENDILLLGDDPWESFVNNVWYIKIL 785
>ARFL_ARATH (Q9XID4) Putative auxin response factor 12| Length = 593 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 + D D D MLVGD PW F K++ I K Sbjct: 562 FTDSDEDKMLVGDDPWPEFCNMVKKIFIQK 591
>ROGF2_ARATH (Q9LQ89) Rop guanine nucleotide exchange factor 2 (RopGEF2)| Length = 516 Score = 30.8 bits (68), Expect = 1.4 Identities = 11/19 (57%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -3 Query: 55 IIIQKKKVRWWLPLP-VPL 2 +I+Q+K+ +WWLP+P VPL Sbjct: 296 VIVQRKEEKWWLPIPLVPL 314
>ARFU_ARATH (Q9C8N9) Putative auxin response factor 21| Length = 606 Score = 30.4 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 + D DG MLVGD PW F K++ I E L Sbjct: 562 FTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKNL 598
>ARFT_ARATH (Q9C7I9) Putative auxin response factor 20| Length = 606 Score = 30.4 bits (67), Expect = 1.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGL 310 + D DG MLVGD PW F K++ I E L Sbjct: 562 FTDSDGYEMLVGDDPWPEFCKMVKKILIYSKEEVKNL 598
>ISPDF_RHOCA (Q08113) IspD/ispF bifunctional enzyme [Includes:| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclod Length = 379 Score = 29.6 bits (65), Expect = 3.1 Identities = 23/67 (34%), Positives = 27/67 (40%), Gaps = 16/67 (23%) Frame = +1 Query: 253 LEMDPRSAPALAFLHCPWREPDGF*S----------------FHYPEALARRDEHLPGDV 384 LE P +APALA WR G + F +PE LA H PG Sbjct: 116 LETTPGAAPALAVTDALWRGEAGLVAGTQDREGLYRAQTPQGFRFPEILAAHRAH-PGGA 174 Query: 385 ADEHPVA 405 AD+ VA Sbjct: 175 ADDVEVA 181
>ARFO_ARATH (Q9LQE3) Putative auxin response factor 15| Length = 593 Score = 29.6 bits (65), Expect = 3.1 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 420 YEDKDGDWMLVGDVPWEMFVASCKRLRIMK 331 + D D MLVGD PW F KR+ I K Sbjct: 562 FTGSDEDEMLVGDDPWPEFCNMVKRIYIQK 591
>GLND_BRAJA (Q89VX9) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 929 Score = 29.6 bits (65), Expect = 3.1 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 144 ILYVLPYMTTRWNRRYEVAVLVILW---YRVGQA 236 +L++LPY T W + A+L LW +VG A Sbjct: 127 LLFILPYKQTAWGEQVAEAILYCLWDMGLKVGHA 160
>GLND_NITWN (Q3SWE0) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 925 Score = 29.3 bits (64), Expect = 4.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 144 ILYVLPYMTTRWNRRYEVAVLVILW 218 +L++LPY T W + A+L LW Sbjct: 127 LLFILPYKQTAWGEQVAEAILYCLW 151
>MURB_PROAC (Q6A6J8) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 376 Score = 28.9 bits (63), Expect = 5.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 265 GPFQDYDCVYACPTLYHNITSTAT 194 GP++D D AC T++H + T T Sbjct: 7 GPYEDDDPTEACSTIHHEVIGTTT 30
>CYB_ASPMU (Q9MLL4) Cytochrome b| Length = 372 Score = 28.5 bits (62), Expect = 6.9 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 9/41 (21%) Frame = +3 Query: 69 YPLLAKGKYY*LYVNSDIFLTYTYYIL---------YVLPY 164 Y +A+G YY LY+N +++L+ T ++ YVLP+ Sbjct: 87 YTHIARGLYYGLYLNKEVWLSGTVLLMLLMATAFFGYVLPW 127
>P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)| Length = 339 Score = 28.5 bits (62), Expect = 6.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 159 PYMTTRWNRRYEVAVLVILWYRVGQA 236 P+ W RRY+V + +W VG A Sbjct: 138 PFRARDWKRRYDVGISAAIWIVVGTA 163
>CYB_PSEAU (Q9MLK4) Cytochrome b| Length = 372 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 9/41 (21%) Frame = +3 Query: 69 YPLLAKGKYY*LYVNSDIFLTYTYYIL---------YVLPY 164 Y +A+G YY LY+N +++L+ T ++ YVLP+ Sbjct: 87 YTHIARGLYYGLYLNKEVWLSGTALLIVLMATAFFGYVLPW 127
>GLND_RHOPA (P62223) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 929 Score = 28.1 bits (61), Expect = 9.0 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +3 Query: 144 ILYVLPYMTTRWNRRYEVAVLVILW---YRVGQA 236 +L++LPY T W + +L LW +VG A Sbjct: 123 LLFILPYKQTAWGEQVAEVILYCLWDIGLKVGHA 156
>IF2B_NANEQ (Q74M98) Translation initiation factor 2 beta subunit| (eIF-2-beta) (aIF2-beta) Length = 139 Score = 28.1 bits (61), Expect = 9.0 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 94 YFPLASRGYPSIIIIIQKKKVRWWLPLP 11 YF L R Y + +I+++++RW P+P Sbjct: 5 YFELLERAYQKLKDVIKQEQIRWNPPIP 32 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,233,840 Number of Sequences: 219361 Number of extensions: 1105637 Number of successful extensions: 2930 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 2878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2928 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
