Clone Name | rbart17f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DMXL1_HUMAN (Q9Y485) Protein DmX-like 1 (X-like 1 protein) | 29 | 2.8 | 2 | YRDR_BACSU (O07086) Hypothetical transport protein yrdR | 29 | 3.7 | 3 | PLSL_MOUSE (Q61233) Plastin-2 (L-plastin) (Lymphocyte cytosolic ... | 28 | 4.8 | 4 | DMXL1_MOUSE (Q6PNC0) Protein DmX-like 1 (X-like 1 protein) | 28 | 6.3 |
---|
>DMXL1_HUMAN (Q9Y485) Protein DmX-like 1 (X-like 1 protein)| Length = 3027 Score = 29.3 bits (64), Expect = 2.8 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +3 Query: 15 YLKYFFHGLRPHSAP*ANPTETARI*RSP-NEKKYCSIMLGG--TSEKPQNHTYT 170 YL F HGL HS+ E RI P NEK + ++ GG K Q H+ T Sbjct: 2327 YLSLFIHGLATHSS-----NELFRIVAHPLNEKMWSAVFGGGAHVPSKEQTHSKT 2376
>YRDR_BACSU (O07086) Hypothetical transport protein yrdR| Length = 321 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -1 Query: 187 KYVTISV*VWFCGFSEVPPNIMLQYFFSLGDR--HILAVSVGL 65 KY IS+ + F G S V + +FFSLGD IL + +G+ Sbjct: 128 KYTMISILIAFLGASMVITKGNISFFFSLGDHLFSILFIFIGV 170
>PLSL_MOUSE (Q61233) Plastin-2 (L-plastin) (Lymphocyte cytosolic protein 1)| (LCP-1) (65 kDa macrophage protein) (pp65) Length = 627 Score = 28.5 bits (62), Expect = 4.8 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +3 Query: 9 DDYLKYFFHGLRPHSAP*ANPTETARI*RSPNEKKYCSIMLGGTSEKPQ---NHTYTEMV 179 D+++K F HGL+ TE A+ R KK +GGTSE+ H+Y+E Sbjct: 72 DEFIKVF-HGLKS--------TEVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEE 122 Query: 180 TY 185 Y Sbjct: 123 KY 124
>DMXL1_MOUSE (Q6PNC0) Protein DmX-like 1 (X-like 1 protein)| Length = 3013 Score = 28.1 bits (61), Expect = 6.3 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 15 YLKYFFHGLRPHSAP*ANPTETARI*RSPNEKKYCSIMLGGTSEKP 152 YL F HGL HS+ E RI P +K S + GG + P Sbjct: 2321 YLSLFIHGLATHSS-----NELFRIVAHPLNEKMWSAVFGGGAHVP 2361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,086,335 Number of Sequences: 219361 Number of extensions: 609544 Number of successful extensions: 1248 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)