Clone Name | rbart17e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNDA_BACSU (O31805) Hypothetical protein yndA precursor | 34 | 0.090 |
---|
>YNDA_BACSU (O31805) Hypothetical protein yndA precursor| Length = 132 Score = 34.3 bits (77), Expect = 0.090 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 55 LRF-KIIGFNFILALV*NYTKFKRTEGVHTRAKPPWDELGHHTYTSC*PTSY 207 +RF K++GF +L L + + E T WD+LG +TYT PT Y Sbjct: 1 MRFTKVVGFLSVLGLAAVFPLTAQAEKAGTAGAGEWDKLGTYTYTYSSPTVY 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,679,048 Number of Sequences: 219361 Number of extensions: 509275 Number of successful extensions: 1122 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1122 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)