Clone Name | rbart17b12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TT1_ARATH (Q8VWG3) TRANSPARENT TESTA 1 protein (Zinc finger prot... | 30 | 4.6 | 2 | RL4_CORGL (Q8NT08) 50S ribosomal protein L4 | 30 | 4.6 | 3 | DHX9_XENLA (Q68FK8) ATP-dependent RNA helicase A-like protein (E... | 29 | 7.8 |
---|
>TT1_ARATH (Q8VWG3) TRANSPARENT TESTA 1 protein (Zinc finger protein TT1)| (TTL1) Length = 303 Score = 29.6 bits (65), Expect = 4.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 48 QRLEITPGQSQTSCTVNTSLQPLPL 122 Q L++ P +Q SC NT ++PLPL Sbjct: 23 QSLDLFPNLNQNSCINNTLIEPLPL 47
>RL4_CORGL (Q8NT08) 50S ribosomal protein L4| Length = 218 Score = 29.6 bits (65), Expect = 4.6 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = +3 Query: 57 EITPGQSQTSCTVNTSLQPLPLKIGMLSSVITEEVHSRNEANNKP*INESGTKHLTRYIA 236 E+ PGQ+ ++ + ++ L + +L V E+++++ ANN P ++ L Y Sbjct: 130 ELVPGQTPSTKSAKAFIERLTERKSVLLVVSREDINAQKSANNLPGVHILAADQLNTYDV 189 Query: 237 L 239 L Sbjct: 190 L 190
>DHX9_XENLA (Q68FK8) ATP-dependent RNA helicase A-like protein (EC 3.6.1.-)| (Nuclear DNA helicase II) (NDH II) (DEAH box protein 9) Length = 1262 Score = 28.9 bits (63), Expect = 7.8 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +3 Query: 21 YALIINKVLQRLEITPGQSQTSCTVNTSLQPLPLKIGMLSSVITEEVHSRN 173 Y++ VL R P S CTV L+ L I +S VI +E+H R+ Sbjct: 473 YSVRFESVLPR----PHASMLFCTVGVLLRKLESGIRGISHVIVDEIHERD 519 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,935,665 Number of Sequences: 219361 Number of extensions: 1243983 Number of successful extensions: 2748 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2748 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)