Clone Name | rbart17b05 |
---|---|
Clone Library Name | barley_pub |
>HSP72_ARATH (P22954) Heat shock cognate 70 kDa protein 2 (Hsc70.2)| Length = 653 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 220 SGGAGPKIEEVD 185 SGGAGPKIEEVD Sbjct: 642 SGGAGPKIEEVD 653
>ROS_AVISU (P00529) Tyrosine-protein kinase transforming protein ros (EC| 2.7.10.1) Length = 402 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 215 RCWAQDRGGRLS*FSFIVRNTLYAICFGPGCQSYPLG*K 99 RCWAQD R + F +++ L I P C SY LG K Sbjct: 350 RCWAQDPHNRPT--FFYIQHKLQEIRHSPLCFSYFLGDK 386
>HSP71_ARATH (P22953) Heat shock cognate 70 kDa protein 1 (Hsc70.1)| Length = 651 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -2 Query: 220 SGGAGPKIEEVD 185 SGGAGPKIEEVD Sbjct: 640 SGGAGPKIEEVD 651
>SPEA_PROMP (Q7V3M9) Biosynthetic arginine decarboxylase (EC 4.1.1.19) (ADC)| Length = 648 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 68 TDTLVSRLNKIFNPGDMIGTQGRNKWRIGYFSL*KRTNL 184 TD +LNK + D I T G +KW YFS+ N+ Sbjct: 2 TDFDTKKLNKKWTIEDSISTYGIDKWGEKYFSINSEGNI 40
>ROS_CHICK (P08941) Proto-oncogene tyrosine-protein kinase ROS precursor (EC| 2.7.10.1) (c-ros-1) Length = 2311 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 215 RCWAQDRGGRLS*FSFIVRNTLYAICFGPGCQSYPLG*K 99 RCWAQD R + F +++ L I P C SY LG K Sbjct: 2213 RCWAQDPHNRPT--FFYIQHKLQEIRHSPLCFSYFLGDK 2249
>RIMB1_RAT (Q9JIR0) Peripheral-type benzodiazepine receptor-associated protein 1| (PRAX-1) (RIM-binding protein 1) (RIM-BP1) Length = 1847 Score = 28.5 bits (62), Expect = 4.7 Identities = 20/69 (28%), Positives = 25/69 (36%), Gaps = 20/69 (28%) Frame = +1 Query: 121 WHPGPKQMAYRVFLTMKEN*LSRPPRSWA--------------------QHRRWEPAHHR 240 W PG +A+ V+L +E +RP WA WEP R Sbjct: 900 WVPGNSNLAHAVYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWER 959 Query: 241 PCLRACQHQ 267 P LRA Q Sbjct: 960 PELRAATLQ 968
>PYRC_SULAC (O08357) Dihydroorotase (EC 3.5.2.3) (DHOase)| Length = 389 Score = 28.1 bits (61), Expect = 6.1 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = -3 Query: 195 RRSTKLVLFHSEKYPIRHLFRPWVPIISPGLKILFNRETSVSVLTIAMMHVLVIVDFSLM 16 + T+ VL S+K I H P+V I L+ + ET+ L MH+ I +F + Sbjct: 141 KEETRYVLEKSKKLKILHPEMPFVSKIERSLRRSYWMETAAINLVKGNMHITHITNFETL 200
>US01_HCMVA (P09714) Hypothetical protein HQLF3| Length = 156 Score = 28.1 bits (61), Expect = 6.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 39 PKHASLQWLKQIH*SHD 89 P+HA QW +Q+H +HD Sbjct: 60 PEHAEAQWRQQVHAAHD 76 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,886,937 Number of Sequences: 219361 Number of extensions: 755761 Number of successful extensions: 1990 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1980 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1989 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)