Clone Name | rbart16d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAS1_SHEEP (P04653) Alpha-S1-casein precursor | 28 | 7.0 | 2 | YO17_AMEPV (P28853) Hypothetical protein AMV017/Q1 | 28 | 7.0 | 3 | CAS1_CAPHI (P18626) Alpha-S1-casein precursor (Alpha-S1-CN) (Var... | 28 | 9.1 |
---|
>CAS1_SHEEP (P04653) Alpha-S1-casein precursor| Length = 214 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = -2 Query: 146 MRTKISSMRLLRFIYVISPFPEAFRRSN 63 + +++ + LLRF V++PFPE FR+ N Sbjct: 26 LSSEVLNENLLRF--VVAPFPEVFRKEN 51
>YO17_AMEPV (P28853) Hypothetical protein AMV017/Q1| Length = 66 Score = 28.1 bits (61), Expect = 7.0 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 7 RNNIPSF*DHNGSTHDITLFERRKASGKGEIT*INLNNRM 126 +NN + D G+ DI+L +R+K GK +N+NN + Sbjct: 2 QNNDNYYSDIEGAKSDISLVDRKKKIGKMINNIVNINNEL 41
>CAS1_CAPHI (P18626) Alpha-S1-casein precursor (Alpha-S1-CN) (Variants A, B, C,| D, E and F) Length = 214 Score = 27.7 bits (60), Expect = 9.1 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 137 KISSMRLLRFIYVISPFPEAFRRSN 63 ++ + LLRF V++PFPE FR+ N Sbjct: 29 EVPNENLLRF--VVAPFPEVFRKEN 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,423,995 Number of Sequences: 219361 Number of extensions: 231341 Number of successful extensions: 386 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)