| Clone Name | rbart16c06 |
|---|---|
| Clone Library Name | barley_pub |
>DRE1B_ARATH (P93835) Dehydration-responsive element-binding protein 1B (DREB1B| protein) (C-repeat-binding factor 1) (C-repeat/dehydration-responsive element-binding factor 1) (CRT/DRE-binding factor 1) Length = 213 Score = 31.6 bits (70), Expect = 0.93 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = -3 Query: 446 QGMLIAPPPLVGPSATAGDGDDDGEVSLWSY 354 +GML+ PPP V + DG+ DG+VSLWSY Sbjct: 185 EGMLL-PPPSVQWNHNY-DGEGDGDVSLWSY 213
>NRG2_HUMAN (O14511) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK) (Divergent of neuregulin-1) (DON-1)] Length = 850 Score = 30.0 bits (66), Expect = 2.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -2 Query: 279 RVEEVYCMVALSFSPLCSKLLWVMYVCSLMNCDQKKQR 166 + EE+Y L+ + +C LL V VC + C KKQR Sbjct: 397 KAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQR 434
>NRG2_MOUSE (P56974) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Divergent of neuregulin 1) (DON-1)] Length = 756 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 273 EEVYCMVALSFSPLCSKLLWVMYVCSLMNCDQKKQR 166 EE+Y L+ + +C LL V VC + C KKQR Sbjct: 309 EELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQR 344
>NRG1_RAT (P43322) Pro-neuregulin-1, membrane-bound isoform precursor| (Pro-NRG1) [Contains: Neuregulin-1 (Neu differentiation factor) (Heregulin) (HRG) (Acetylcholine receptor-inducing activity) (ARIA) (Sensory and motor neuron-derived factor) (Glial grow Length = 662 Score = 29.3 bits (64), Expect = 4.6 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 282 NRVEEVYCMVALSFSPLCSKLLWVMYVCSLMNCDQKKQR 166 ++ EE+Y L+ + +C LL V +C + C KKQR Sbjct: 256 SKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQR 294
>NRG2_RAT (O35569) Pro-neuregulin-2, membrane-bound isoform precursor| (Pro-NRG2) [Contains: Neuregulin-2 (NRG-2) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)] Length = 868 Score = 29.3 bits (64), Expect = 4.6 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 273 EEVYCMVALSFSPLCSKLLWVMYVCSLMNCDQKKQR 166 EE+Y L+ + +C LL V VC + C KKQR Sbjct: 423 EELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQR 458
>NRG1_HUMAN (Q02297) Pro-neuregulin-1, membrane-bound isoform precursor| (Pro-NRG1) [Contains: Neuregulin-1 (Neu differentiation factor) (Heregulin) (HRG) (Breast cancer cell differentiation factor p45) (Acetylcholine receptor-inducing activity) (ARIA) (Se Length = 639 Score = 28.9 bits (63), Expect = 6.0 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -2 Query: 279 RVEEVYCMVALSFSPLCSKLLWVMYVCSLMNCDQKKQR 166 + EE+Y L+ + +C LL V +C + C KKQR Sbjct: 233 KAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQR 270
>EF1D_PIMBR (P93447) Elongation factor 1-delta (EF-1-delta) (Elongation factor| 1B-beta) (eEF-1B beta) Length = 225 Score = 28.5 bits (62), Expect = 7.9 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -3 Query: 446 QGMLIAPPPLVGPSATAGDGDDDGEVSLW 360 +G +A PP+ A+A + DDD +V L+ Sbjct: 79 EGSSVATPPVADTKASAAEDDDDDDVDLF 107
>MRAW_FUSNN (Q8R6F5) S-adenosyl-methyltransferase mraW (EC 2.1.1.-)| Length = 314 Score = 28.5 bits (62), Expect = 7.9 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 5/81 (6%) Frame = +1 Query: 28 IIHPETYILLNQTPTKTFRSCIINKGDTYS*PQHSFGARTLHSRSGPLLLLIAVHQRAN- 204 +++ ET L P T+ C + G HS G S G LLI++ Q N Sbjct: 12 VLYYETLDNLVINPDGTYIDCTLGGGS------HSEGILERLSDKG---LLISIDQDTNA 62 Query: 205 VHYP----EKFRTKWRKGKGN 255 + Y EKF +KW+ KGN Sbjct: 63 IEYSKKRLEKFGSKWKVFKGN 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,207,741 Number of Sequences: 219361 Number of extensions: 1144854 Number of successful extensions: 2613 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2607 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)