Clone Name | rbart16b09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TMOA_PSEME (Q00456) Toluene-4-monooxygenase system protein A (EC... | 29 | 3.8 | 2 | NUCC_PSINU (Q8WHX3) NAD(P)H-quinone oxidoreductase chain H, chlo... | 28 | 6.5 |
---|
>TMOA_PSEME (Q00456) Toluene-4-monooxygenase system protein A (EC 1.14.13.-)| Length = 499 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 37 KSSVWVPGNTEQEQE*PIKLGKQIGIPR*HGRWEKRAPPIKKKFPQ 174 +++ W P +EQ P ++ +GIP +WE P K +P+ Sbjct: 13 RATNWTPSYVTEEQLFPERMSGHMGIPL--EKWESYDEPYKTSYPE 56
>NUCC_PSINU (Q8WHX3) NAD(P)H-quinone oxidoreductase chain H, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain H) (NADH-plastoquinone oxidoreductase 49 kDa subunit) Length = 393 Score = 28.1 bits (61), Expect = 6.5 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 75 ARVAHQTWKTNWNSTVTRTMGKKGPPHQKKIPSKHPV 185 AR HQ+ WN + MGKK P K + +H V Sbjct: 292 ARRLHQSQNLEWNDFDYQFMGKKSSPTFKLLKQEHYV 328 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,242,210 Number of Sequences: 219361 Number of extensions: 570170 Number of successful extensions: 1622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1621 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)