| Clone Name | rbart16b08 |
|---|---|
| Clone Library Name | barley_pub |
>K6PF_DICDI (P90521) 6-phosphofructokinase (EC 2.7.1.11) (Phosphofructokinase)| (Phosphohexokinase) Length = 834 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 291 RRPRAWWWSDPRDSSSAQSCFPKPNPS 211 RRPR+ WW D ++S S FP +PS Sbjct: 764 RRPRSQWWMDLVETSQNISVFPLDDPS 790
>YKT6_CAEEL (P34317) Hypothetical protein C07A9.6 precursor| Length = 507 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 30 WLTHGIQIYRADVIQIARRPTQS-IPHLLHKVG 125 W+THG IY +Q+ R S IPH L G Sbjct: 163 WITHGTSIYEFSAVQLGLRTIPSTIPHPLSSAG 195
>CRTB_SYNY3 (P37294) Phytoene synthase (EC 2.5.1.-)| Length = 337 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = -3 Query: 288 RPRAWWW-SDPRDSSSAQSCFPKPNPSVQRSPSTE 187 +P++WW S+PR S Q PKP+PS + S E Sbjct: 14 KPQSWWLTSEPRPSLMLQ--LPKPSPSAKPCASVE 46
>CDON_HUMAN (Q4KMG0) Cell adhesion molecule-related/down-regulated by oncogenes| precursor Length = 1287 Score = 28.9 bits (63), Expect = 3.4 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -3 Query: 258 RDSSSAQSCFPKPNPSVQRSPSTEIKAFAVPASVGLTFKPL-QV*VPLCVAN 106 R+ + CF K N + SP + A GL KPL V VP+C+ + Sbjct: 1112 RNCRNNNRCFTKTNSTFSSSPPPVVPVVAPYPQDGLEMKPLSHVKVPVCLTS 1163
>LRTM1_MOUSE (Q8K377) Leucine-rich repeat transmembrane neuronal protein 1| precursor Length = 522 Score = 28.9 bits (63), Expect = 3.4 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 23 CTLADTWNSNIQGRRNSNRQKANTEYS 103 C LA +W SN QGR ++N Q A+ EY+ Sbjct: 323 CALA-SWLSNFQGRYDANLQCASPEYA 348
>LRTM1_PONPY (Q5R6B1) Leucine-rich repeat transmembrane neuronal protein 1| precursor Length = 522 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 23 CTLADTWNSNIQGRRNSNRQKANTEYS 103 C LA +W SN QGR + N Q A+ EY+ Sbjct: 323 CALA-SWLSNFQGRYDGNLQCASPEYA 348
>LRTM1_HUMAN (Q86UE6) Leucine-rich repeat transmembrane neuronal protein 1| precursor Length = 522 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 23 CTLADTWNSNIQGRRNSNRQKANTEYS 103 C LA +W SN QGR + N Q A+ EY+ Sbjct: 323 CALA-SWLSNFQGRYDGNLQCASPEYA 348
>CYSK_WHEAT (P38076) Cysteine synthase (EC 2.5.1.47) (O-acetylserine| sulfhydrylase) (O-acetylserine (Thiol)-lyase) (CSase A) (OAS-TL A) Length = 325 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 304 HSIKKEAESMVVE 266 HSIKKEAESMVVE Sbjct: 313 HSIKKEAESMVVE 325
>ANLN_HUMAN (Q9NQW6) Actin-binding protein anillin| Length = 1124 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 2/37 (5%) Frame = -3 Query: 261 PRDSSSAQSCFPKP-NPSVQ-RSPSTEIKAFAVPASV 157 P +S+SA+SC P P +P VQ ++ T + AVPAS+ Sbjct: 87 PVESTSAKSCSPSPVSPQVQPQAADTISDSVAVPASL 123
>ATPZ_STRLI (P0A303) ATP synthase protein I| Length = 144 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +3 Query: 69 IQIARRPTQSIPHLLHKVGLKLARA*MSDQH*QGQQKLLFL*RGSFERRDLASENSFARS 248 + + +R +S+PHL +GL L A Q LLF+ +F+ L + SFA S Sbjct: 54 LYVLQRTAKSLPHLFQAMGLMLYAA---------QILLLFVFLAAFKNTTLFNPRSFAVS 104
>ATPZ_STRCO (P0A302) ATP synthase protein I| Length = 144 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +3 Query: 69 IQIARRPTQSIPHLLHKVGLKLARA*MSDQH*QGQQKLLFL*RGSFERRDLASENSFARS 248 + + +R +S+PHL +GL L A Q LLF+ +F+ L + SFA S Sbjct: 54 LYVLQRTAKSLPHLFQAMGLMLYAA---------QILLLFVFLAAFKNTTLFNPRSFAVS 104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,684,221 Number of Sequences: 219361 Number of extensions: 817839 Number of successful extensions: 2593 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2589 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)