Clone Name | rbart16b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein) | 30 | 4.8 | 2 | MATK_DANSP (Q9MUY2) Maturase K (Intron maturase) | 30 | 4.8 | 3 | YG4U_YEAST (P53308) Hypothetical 11.9 kDa protein in DIE2-SMI1 i... | 29 | 8.2 |
---|
>UL53_HCMVA (P16794) Protein UL53 (HFRF2 protein)| Length = 376 Score = 29.6 bits (65), Expect = 4.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 302 GCPPSARSSSHQPHACPPSSALEWNPY 222 GC PS+ S S PH PPS A + + Y Sbjct: 321 GCGPSSSSQSTPPHLHPPSQATQPHHY 347
>MATK_DANSP (Q9MUY2) Maturase K (Intron maturase)| Length = 513 Score = 29.6 bits (65), Expect = 4.8 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +2 Query: 5 QTQTRYSFHTRLSSCAYTSQTKKKSATRCVVAARRQSF-KSFFTIRFPIDRMQQHTPYLL 181 QT R + RLS CA T K KS R + F + FFT ++ + L Sbjct: 427 QTLYRLKYILRLS-CARTLARKHKSTVRTFMQRLGSVFLEEFFT--------EEEQVFSL 477 Query: 182 TYLRTTHYP*AKTHRDSI 235 +++TTH+ +H D I Sbjct: 478 MFIKTTHFSFHGSHSDRI 495
>YG4U_YEAST (P53308) Hypothetical 11.9 kDa protein in DIE2-SMI1 intergenic| region Length = 114 Score = 28.9 bits (63), Expect = 8.2 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 13/72 (18%) Frame = +2 Query: 329 SSSTLASFSPRLASADARFSSALCRALATSF-----------CVFSTALARCSSSFLSI- 472 +SSTLAS S ++ + F S++C ++SF C FS+ SSSFLS+ Sbjct: 17 ASSTLAS-SLLISFSSFLFISSVCLFTSSSFFADSVTCSFSTCSFSSTFGCFSSSFLSLS 75 Query: 473 -FLSQADALSTC 505 +S AL +C Sbjct: 76 CLMSTLSALISC 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,039,367 Number of Sequences: 219361 Number of extensions: 1055616 Number of successful extensions: 3208 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3197 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)