Clone Name | rbart16b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 29 | 3.5 | 2 | ROBO3_HUMAN (Q96MS0) Roundabout homolog 3 precursor (Roundabout-... | 28 | 4.5 | 3 | DSX_DROME (P23023) Protein doublesex | 28 | 5.9 | 4 | VIT6_CAEEL (P18948) Vitellogenin 6 precursor | 28 | 5.9 |
---|
>ADA19_MOUSE (O35674) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) Length = 920 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/44 (40%), Positives = 22/44 (50%) Frame = +1 Query: 130 PRSWQRAQRRESHQRPLSS**MADASNLT*MCLKSWSVHRPSPP 261 P + R +R+ES +RP S M A N CL S RP PP Sbjct: 821 PEAGARIERKESARRPPPSRPMPPAPN----CLLSQDFSRPRPP 860
>ROBO3_HUMAN (Q96MS0) Roundabout homolog 3 precursor (Roundabout-like protein 3)| Length = 1386 Score = 28.5 bits (62), Expect = 4.5 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = -3 Query: 274 SSWSRGEMGDGRSRTSSTFKLSYSHRPFTRRR 179 SS SRG G GRSR+ S + S S RP +RR Sbjct: 1352 SSSSRGSRGPGRSRSRSQSR-SQSQRPGQKRR 1382
>DSX_DROME (P23023) Protein doublesex| Length = 549 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +2 Query: 14 HHIHVSLMHSGYCWKHSLILHKMGNILGTVDKP*AVI*NLGLGNEHSAVNHINAHS 181 HH+H H G+ H +LH P A +LG + ++ H +AH+ Sbjct: 132 HHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHA 187
>VIT6_CAEEL (P18948) Vitellogenin 6 precursor| Length = 1650 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 79 NGKYTRNGRQTVSRYLKP--RSWQRAQRRESHQRPLS 183 NGK + +Q S Y P SW R Q RE + PL+ Sbjct: 1580 NGKSQESKKQKTSVYCLPSSNSWARRQMREIRREPLA 1616 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,129,265 Number of Sequences: 219361 Number of extensions: 853136 Number of successful extensions: 1964 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1963 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)