Clone Name | rbart16a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RAVR2_HUMAN (Q9HCJ3) Protein raver-2 | 28 | 7.1 |
---|
>RAVR2_HUMAN (Q9HCJ3) Protein raver-2| Length = 691 Score = 28.1 bits (61), Expect = 7.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 34 YVQINMEHSQALAGNSQQIWLAGLSDHPMAQK 129 ++ +N H ++ GN+ ++L LS P+AQ+ Sbjct: 389 FLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQ 420 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,220,952 Number of Sequences: 219361 Number of extensions: 268292 Number of successful extensions: 649 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 80,573,946 effective HSP length: 18 effective length of database: 76,625,448 effective search space used: 1839010752 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)