| Clone Name | rbart16a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1 | 29 | 2.8 | 2 | DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protei... | 29 | 3.7 | 3 | SCE3_SCHPO (O14369) Probable RNA-binding protein sce3 | 28 | 8.3 | 4 | POL4_DROME (P10394) Retrovirus-related Pol polyprotein from tran... | 28 | 8.3 |
|---|
>CPRF1_PETCR (Q99089) Common plant regulatory factor CPRF-1| Length = 411 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 83 LYNQNGAVIHVQYRAEAEHALNQPLPADHQKKNGTGRTTNASSYVKN 223 L N N ++ V A+AE A + L +++KK T T N S V N Sbjct: 325 LTNDNSRLLEVMKNAQAERAADVGLGNNNEKKASTLSTANLLSRVDN 371
>DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protein dicer-1)| Length = 2249 Score = 28.9 bits (63), Expect = 3.7 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +1 Query: 34 DRNDNRVHRKYTQNPLSI*--PKWSGNSRTVQSGSRTCTKPTTTRRSPKEKRDGTDNQCI 207 DR NR + T P PK S + T Q +R + TRR ++ DG+D C Sbjct: 439 DRQTNRSAARVTPTPTPAHAKPKPSSGANTAQPRTR---RRVYTRRHHRDHNDGSDTLCA 495 Query: 208 IV 213 ++ Sbjct: 496 LI 497
>SCE3_SCHPO (O14369) Probable RNA-binding protein sce3| Length = 388 Score = 27.7 bits (60), Expect = 8.3 Identities = 18/74 (24%), Positives = 32/74 (43%) Frame = +1 Query: 1 EKLRGDFIEWMDRNDNRVHRKYTQNPLSI*PKWSGNSRTVQSGSRTCTKPTTTRRSPKEK 180 +++R + EW+ R + L++ P+ S N T + S T T + +R P Sbjct: 218 DRVREEPREWVRRGPLPPRESSERPRLNLKPRSSSNVNTEATPSATTTTSSKPKRDPFGG 277 Query: 181 RDGTDNQCIIVRQE 222 DN ++ R E Sbjct: 278 AKPVDNTSVLQRVE 291
>POL4_DROME (P10394) Retrovirus-related Pol polyprotein from transposon 412| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1237 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = +2 Query: 20 LLNGWTEMIIEYTENIHKILSLYNQNGAVIHVQYRAEAEHALNQPLPADHQKKN 181 L+ G T + ++ +H I +YN + +YR E +A + L H++KN Sbjct: 1114 LVFGRTSNLPKHFNKLHSIEPIYNIDDYAKESKYRLEVAYARARKLLEAHKEKN 1167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,761,832 Number of Sequences: 219361 Number of extensions: 579697 Number of successful extensions: 1661 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)