| Clone Name | rbart15f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | JTB_HUMAN (O76095) Protein JTB precursor (Jumping translocation ... | 31 | 1.9 | 2 | PRDM8_HUMAN (Q9NQV8) PR domain zinc finger protein 8 (PR domain-... | 30 | 3.2 | 3 | D250_ASFB7 (P32092) Protein D250R | 30 | 4.1 | 4 | JTB_MOUSE (O88824) Protein JTB precursor | 29 | 5.4 | 5 | SMOO_HUMAN (P53814) Smoothelin | 29 | 7.1 | 6 | RIR1_MIMIV (Q7T6Y8) Ribonucleoside-diphosphate reductase large c... | 29 | 7.1 | 7 | SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains prote... | 28 | 9.2 |
|---|
>JTB_HUMAN (O76095) Protein JTB precursor (Jumping translocation breakpoint| protein) (Prostate androgen-regulated protein) (PAR protein) Length = 146 Score = 30.8 bits (68), Expect = 1.9 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Frame = +1 Query: 121 IPCSSTKRNKILGCRS-------LSHMEGVI*CVLYI*SCFLI 228 I CSS+KRN+ CRS EG + CV I +C +I Sbjct: 83 ITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVI 125
>PRDM8_HUMAN (Q9NQV8) PR domain zinc finger protein 8 (PR domain-containing| protein 8) Length = 689 Score = 30.0 bits (66), Expect = 3.2 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -3 Query: 401 SAFGKVAKAAT-----DVGTMTKEKMSAEEQQKGSGGSSYTPIR*SP 276 SAF +V KAA + GT +++E+Q G GG S TP SP Sbjct: 384 SAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGGGSSTPAAASP 430
>D250_ASFB7 (P32092) Protein D250R| Length = 250 Score = 29.6 bits (65), Expect = 4.1 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 8/48 (16%) Frame = +3 Query: 27 YYSILPQLKK------GKGSFQH--YLEPFCNNM*NPKVNSLLFYKEK 146 YY ILP+ KK GK ++H +L C ++ P +N L Y+ + Sbjct: 158 YYQILPEFKKSMSYFDGKTEYKHIYFLAMLCKSLEEPNMNLSLQYENR 205
>JTB_MOUSE (O88824) Protein JTB precursor| Length = 146 Score = 29.3 bits (64), Expect = 5.4 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Frame = +1 Query: 121 IPCSSTKRNKILGCRSL---SHM----EGVI*CVLYI*SCFLI 228 I CSS+KRN+ CRS H+ EGV+ V + +C +I Sbjct: 83 ITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVFACLVI 125
>SMOO_HUMAN (P53814) Smoothelin| Length = 917 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -3 Query: 401 SAFGKVAKAATDVGTMTKEKMSAEEQQKGSGGSSYTPI--R*SPSPVPHCASPCCII 237 S+F + V T + A Q G+ ++ +P+ R +P P+PH PC ++ Sbjct: 322 SSFQRAGSVRDRVHKFTSDSPMAARLQDGTPQAALSPLTPRKAPGPLPHQHHPCVLL 378
>RIR1_MIMIV (Q7T6Y8) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 881 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = -3 Query: 146 FLFVEEQGIYLGVLHVITKWFKVMLER--TFSFFKLWKDAV 30 +L E +GIYL + I WFK+M + T + ++KDA+ Sbjct: 437 YLKYESEGIYLKQIRAIDLWFKIMESQIETGVPYVMFKDAI 477
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 28.5 bits (62), Expect = 9.2 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Frame = -3 Query: 362 GTMTKEKMSAEEQQKGSGGSS------YTPIR*SPSPVPHCASP 249 G+ T+ + + G GGSS +P+ SPSPVP ASP Sbjct: 1181 GSSTEAEPPTQPDGAGGGGSSPSPAPATSPVPPSPSPVPTPASP 1224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,228,348 Number of Sequences: 219361 Number of extensions: 1332139 Number of successful extensions: 3609 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3609 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)