| Clone Name | rbart15e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FZD8_MOUSE (Q61091) Frizzled 8 precursor (Frizzled-8) (Fz-8) (mFz8) | 29 | 3.1 | 2 | MFD_MYCTU (P64326) Transcription-repair coupling factor (EC 3.6.... | 27 | 9.1 | 3 | MFD_MYCBO (P64327) Transcription-repair coupling factor (EC 3.6.... | 27 | 9.1 | 4 | CS016_HUMAN (Q8ND99) Protein C19orf16 | 27 | 9.1 |
|---|
>FZD8_MOUSE (Q61091) Frizzled 8 precursor (Frizzled-8) (Fz-8) (mFz8)| Length = 685 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 275 SAPRRRGGQCRPPARGATPLGVADACED*MI 183 +AP RGG+ RPP GA P C M+ Sbjct: 206 AAPPSRGGKARPPGGGAAPCEPGCQCRAPMV 236
>MFD_MYCTU (P64326) Transcription-repair coupling factor (EC 3.6.1.-) (TRCF)| (ATP-dependent helicase mfd) Length = 1234 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 313 DIEDGFGFSTMWAPLPDVEEVNADLRLEEPL 221 ++ED FGF+ L +EEV AD+ P+ Sbjct: 640 ELEDAFGFTETVDQLTAIEEVKADMEKPIPM 670
>MFD_MYCBO (P64327) Transcription-repair coupling factor (EC 3.6.1.-) (TRCF)| (ATP-dependent helicase mfd) Length = 1234 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 313 DIEDGFGFSTMWAPLPDVEEVNADLRLEEPL 221 ++ED FGF+ L +EEV AD+ P+ Sbjct: 640 ELEDAFGFTETVDQLTAIEEVKADMEKPIPM 670
>CS016_HUMAN (Q8ND99) Protein C19orf16| Length = 567 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 269 ERSPHGGEPEPVLDVHEQVRQVEQL 343 ERS GG+PEPV+ V Q V ++ Sbjct: 231 ERSQSGGKPEPVVTVRTQETDVVEM 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,804,961 Number of Sequences: 219361 Number of extensions: 349065 Number of successful extensions: 946 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)