Clone Name | rbart15c12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TRPL_CAEEL (P34586) Transient-receptor-potential-like protein (T... | 28 | 4.4 | 2 | EX1_BUCAP (Q8K923) Exodeoxyribonuclease I (EC 3.1.11.1) (Exonucl... | 27 | 9.9 |
---|
>TRPL_CAEEL (P34586) Transient-receptor-potential-like protein (TRP homologous| cation channel protein 1) Length = 1027 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +2 Query: 89 FQT*PKSALNQAIRGCM*PKNVKYCFLFI*IINS 190 FQT P Q GCM K+CF+F+ II+S Sbjct: 536 FQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISS 569
>EX1_BUCAP (Q8K923) Exodeoxyribonuclease I (EC 3.1.11.1) (Exonuclease I) (DNA| deoxyribophosphodiesterase) (dRPase) Length = 482 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/28 (39%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -1 Query: 86 IIGYDNLNYEYRL-HNLVYKNNLGGHVW 6 IIGY+N+N++ + N+ Y+N L + W Sbjct: 100 IIGYNNINFDDEITRNIFYRNFLDPYEW 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,077,212 Number of Sequences: 219361 Number of extensions: 674445 Number of successful extensions: 1167 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1167 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)