Clone Name | rbart15b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PYC_PICPA (P78992) Pyruvate carboxylase (EC 6.4.1.1) (Pyruvic ca... | 30 | 2.8 | 2 | YCC2_YEAST (P25562) Very hypothetical protein YCL022C | 29 | 6.2 |
---|
>PYC_PICPA (P78992) Pyruvate carboxylase (EC 6.4.1.1) (Pyruvic carboxylase)| (PCB) Length = 1189 Score = 30.4 bits (67), Expect = 2.8 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +3 Query: 297 RINLFNLLTSKVSLSSFLPFIDYK-----PFANNRGTVVFWRLLACLKSCF 434 R+N + +TS+ S+S+F+ +D + P AN R +W + L SCF Sbjct: 792 RVNSMSGMTSQPSMSAFIASLDGEIETGIPEANAREIDAYWAEMRLLYSCF 842
>YCC2_YEAST (P25562) Very hypothetical protein YCL022C| Length = 171 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 234 LNLNYTKPHFCFADFSALCLYRINLFNLLTSKVSLSSFLPFIDY 365 LN + P +CF S+LC +LF+ + + +S S LPF ++ Sbjct: 7 LNTRFFNP-YCFQPSSSLCRPSYSLFSGILACISSSKILPFENF 49 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,219,010 Number of Sequences: 219361 Number of extensions: 1256863 Number of successful extensions: 2811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2811 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)