| Clone Name | rbart15a01 |
|---|---|
| Clone Library Name | barley_pub |
>ZN363_MOUSE (Q9CR50) RING finger and CHY zinc finger domain-containing protein| 1 (Zinc finger protein 363) (CH-rich-interacting match with PLAG1) (Androgen receptor N-terminal-interacting protein) Length = 261 Score = 47.0 bits (110), Expect = 3e-05 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -1 Query: 499 VLCNDCNKVSEVDFHVVGHKCSHCNSYNT 413 +LCNDCN S V FH++G KC C+SYNT Sbjct: 220 ILCNDCNGRSTVQFHILGMKCKLCDSYNT 248
>ZN363_HUMAN (Q96PM5) RING finger and CHY zinc finger domain-containing protein| 1 (Zinc finger protein 363) (CH-rich-interacting match with PLAG1) (Androgen receptor N-terminal-interacting protein) Length = 261 Score = 46.6 bits (109), Expect = 4e-05 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -1 Query: 499 VLCNDCNKVSEVDFHVVGHKCSHCNSYNT 413 +LCNDCN S V FH++G KC C SYNT Sbjct: 220 ILCNDCNGRSTVQFHILGMKCKICESYNT 248
>RHO_BORBU (P33561) Transcription termination factor rho (EC 3.6.1.-)| (ATP-dependent helicase rho) Length = 515 Score = 32.7 bits (73), Expect = 0.60 Identities = 17/64 (26%), Positives = 35/64 (54%) Frame = -3 Query: 299 CATNARTIHIEEALFRGMARLVVSTPSLGHCRFTILPRFNSSLEWSATSVLLQTALLDYI 120 C + R I++ + +G L+VS P G + T+L + +++ + + V+L L+D Sbjct: 250 CNISTRLINLFSPIGKGQRALIVSPPKAG--KTTLLQKIANAITTNYSDVILMILLIDER 307 Query: 119 PQEL 108 P+E+ Sbjct: 308 PEEV 311
>ZN606_HUMAN (Q8WXB4) Zinc finger protein 606 (Zinc finger protein 328)| Length = 792 Score = 26.6 bits (57), Expect(2) = 0.66 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHKCSH 431 +CN+C K + H++GH+ +H Sbjct: 485 VCNECGKSFNWNSHLIGHQRTH 506 Score = 24.6 bits (52), Expect(2) = 0.66 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C++C+ S +S+H Sbjct: 534 HTGEKPFKCDECEKAFRDYSALSKH 558
>ZN759_MOUSE (Q80VM4) Zinc finger protein 579| Length = 562 Score = 32.3 bits (72), Expect = 0.78 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -2 Query: 366 RQQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRHGPSSSVNPIPGPLP 205 R++ HL+ + H+G P C +CQ R + ++RH + P P P P Sbjct: 392 RRRAHLRQHG---VTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHPCP 442
>ZN759_HUMAN (Q8NAF0) Zinc finger protein 579| Length = 562 Score = 32.3 bits (72), Expect = 0.78 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -2 Query: 366 RQQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRHGPSSSVNPIPGPLP 205 R++ HL+ + H+G P C +CQ R + ++RH + P P P P Sbjct: 394 RRRAHLRQHG---VTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHPCP 444
>ZN610_HUMAN (Q8N9Z0) Zinc finger protein 610| Length = 462 Score = 25.8 bits (55), Expect(2) = 0.89 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -2 Query: 321 HTGVSPGLCNQC-QNHTHRRSIVSRHGPSSSVNP 223 HTG P CN+C +N H+ S+ + ++ P Sbjct: 310 HTGEKPYKCNECGKNFRHKFSLTNHQRSHTAEKP 343 Score = 25.0 bits (53), Expect(2) = 0.89 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 10/41 (24%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGH----------KCSHCNSYNTRSTS 401 C +C KV + H+V H KCS C+ R+++ Sbjct: 234 CTECGKVFSRNSHLVEHWRIHTGQKPYKCSECDKVFNRNSN 274
>ZN557_HUMAN (Q8N988) Zinc finger protein 557| Length = 423 Score = 29.3 bits (64), Expect(2) = 0.89 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CNQC +SI +RH Sbjct: 251 HTGEKPYKCNQCFREFRTQSIFTRH 275 Score = 21.6 bits (44), Expect(2) = 0.89 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 11/44 (25%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHK----------CSHC-NSYNTRSTSRP 395 CNDC K ++ HK CS C +++ S RP Sbjct: 203 CNDCGKTFSSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRP 246
>ZN206_HUMAN (Q96SZ4) Zinc finger protein 206 (Zinc finger and SCAN| domain-containing protein 10) Length = 725 Score = 26.9 bits (58), Expect(2) = 1.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C QC RR+ ++RH Sbjct: 517 HTGEKPYACPQCGKRFVRRASLARH 541 Score = 23.5 bits (49), Expect(2) = 1.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHKCSH 431 +C+DC K H+V H+ H Sbjct: 468 VCSDCGKAFRRSEHLVAHRRVH 489
>ZFP60_MOUSE (P16374) Zinc finger protein 60 (Zfp-60) (Zinc finger protein| Mfg-3) Length = 707 Score = 29.6 bits (65), Expect(2) = 1.1 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 RI H+GV P CN C +RRS + +H Sbjct: 531 RIIHSGVKPYKCNACGRAFNRRSNLMQH 558 Score = 20.8 bits (42), Expect(2) = 1.1 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 C +C K + HK SH Sbjct: 486 CKECGKAFHFSSQLNNHKTSH 506
>ZN527_HUMAN (Q8NB42) Zinc finger protein 527| Length = 577 Score = 25.4 bits (54), Expect(2) = 1.1 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 366 RQQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 RQ HL + RIH TG P CN+C R + + H Sbjct: 308 RQSAHLAQHQ--RIH-TGEKPFACNECGKAFSRYAFLVEH 344 Score = 25.0 bits (53), Expect(2) = 1.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CNDC K DF + H+ +H Sbjct: 272 CNDCGKAFSHDFFLSEHQRTH 292
>R1A4_SOLDE (Q6L439) Putative late blight resistance protein homolog R1A-4| Length = 1096 Score = 31.6 bits (70), Expect = 1.3 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -3 Query: 242 RLVVSTPSLGHCRFTILPRFNSSLEWSATSVLLQTALLDYIPQEL 108 + V S H FT + ++ +EWSA+S L+ + ++D+IP EL Sbjct: 767 KAVYSHKQHAHLAFT---KMDNLVEWSASSSLVGSVVIDFIPTEL 808
>ZN347_HUMAN (Q96SE7) Zinc finger protein 347 (Zinc finger 1111)| Length = 839 Score = 27.3 bits (59), Expect(2) = 2.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C S +SRH Sbjct: 591 HTGEKPYKCNECGKVFRHNSYLSRH 615 Score = 25.4 bits (54), Expect(2) = 3.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C + S ++RH Sbjct: 759 HTGEKPYKCNECGKAFSQTSKLARH 783 Score = 25.4 bits (54), Expect(2) = 2.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 ++ HTG P CN+C + S ++RH Sbjct: 644 QVIHTGEKPYKCNECGKVFTQNSHLARH 671 Score = 25.4 bits (54), Expect(2) = 2.3 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 ++ HTG P CN+C + S ++RH Sbjct: 560 QVIHTGEKPYKCNECGKVFTQNSHLARH 587 Score = 25.4 bits (54), Expect(2) = 1.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C++C R S ++RH Sbjct: 451 HTGEKPYKCHECGKVFRRNSHLARH 475 Score = 25.0 bits (53), Expect(2) = 3.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C + S ++RH Sbjct: 675 HTGGKPYQCNECGKAFSQTSKLARH 699 Score = 25.0 bits (53), Expect(2) = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRHGPSSS 232 HTG P CN+C RS ++ H + S Sbjct: 367 HTGEKPYKCNECGKAFRARSSLAIHQATHS 396 Score = 25.0 bits (53), Expect(2) = 1.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV + H+V H+ H Sbjct: 347 CNECGKVFTQNSHLVRHRGIH 367 Score = 24.3 bits (51), Expect(2) = 1.8 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 11/41 (26%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGH----------KCSHC-NSYNTRST 404 CN+C KV + H+ H KC+ C ++ RS+ Sbjct: 403 CNECGKVFTQNSHLTNHWRIHTGEKPYKCNECGKAFGVRSS 443 Score = 23.9 bits (50), Expect(2) = 2.3 Identities = 14/44 (31%), Positives = 19/44 (43%), Gaps = 16/44 (36%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGH----------KCSHC------NSYNTR 410 CN+C KV + H+ H KC+ C NSY +R Sbjct: 571 CNECGKVFTQNSHLARHRGIHTGEKPYKCNECGKVFRHNSYLSR 614 Score = 23.9 bits (50), Expect(2) = 2.3 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV + H+ H+ H Sbjct: 515 CNECGKVFTQNSHLANHQRIH 535 Score = 23.5 bits (49), Expect(2) = 3.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV + H+ H+ H Sbjct: 739 CNECGKVFTQNSHLARHRGIH 759 Score = 23.5 bits (49), Expect(2) = 3.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV + H+ H+ H Sbjct: 655 CNECGKVFTQNSHLARHRRVH 675 Score = 21.9 bits (45), Expect(2) = 2.3 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 10/41 (24%) Frame = -1 Query: 496 LCNDCNKV----SEVDFHVVGH------KCSHCNSYNTRST 404 +CN+C K S + H V H KC+ C T+++ Sbjct: 542 MCNECGKAFSVYSSLTTHQVIHTGEKPYKCNECGKVFTQNS 582
>ZN510_HUMAN (Q9Y2H8) Zinc finger protein 510| Length = 683 Score = 29.3 bits (64), Expect(2) = 1.4 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -2 Query: 360 QTHLKTDKL*RIH---HTGVSPGLCNQCQNHTHRRSIVSRH 247 +T +T L R+H HTG P CN+C R++I+S H Sbjct: 579 KTFARTSTL-RVHQRIHTGEKPFKCNECGKKFVRKAILSDH 618 Score = 20.8 bits (42), Expect(2) = 1.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K H++ H+ +H Sbjct: 546 CNECEKSFWRKDHLIQHQKTH 566
>KR18_HUMAN (Q9HCG1) Zinc finger protein Kr18 (HKr18)| Length = 818 Score = 25.0 bits (53), Expect(2) = 1.8 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C S + RH Sbjct: 419 HTGEKPYKCNECGKVFRYNSYLGRH 443 Score = 24.6 bits (52), Expect(2) = 1.8 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 11/41 (26%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGH----------KCSHC-NSYNTRST 404 CN+C K+ + H++ H KC+ C +++ RS+ Sbjct: 371 CNECGKLFTQNSHLISHWRIHTGEKPYKCNECGKAFSVRSS 411 Score = 24.3 bits (51), Expect(2) = 3.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C RS ++ H Sbjct: 699 HTGEKPYRCNECGKAFSVRSSLTTH 723 Score = 24.3 bits (51), Expect(2) = 3.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN C KV + H+ H+ +H Sbjct: 679 CNQCGKVFTQNSHLANHQRTH 699
>ZN600_HUMAN (Q6ZNG1) Zinc finger protein 600| Length = 722 Score = 27.7 bits (60), Expect(2) = 1.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C +++S ++RH Sbjct: 268 HTGEKPYKCNECDKAFNQQSNLARH 292 Score = 21.9 bits (45), Expect(2) = 1.8 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K+ + +V HK H Sbjct: 248 CNECGKIFGQNSALVIHKAIH 268
>ZN304_HUMAN (Q9HCX3) Zinc finger protein 304| Length = 659 Score = 25.0 bits (53), Expect(2) = 2.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P +C++C R S + RH Sbjct: 609 HTGEKPYVCSECGKAYSRSSHLVRH 633 Score = 24.3 bits (51), Expect(2) = 2.3 Identities = 11/41 (26%), Positives = 19/41 (46%), Gaps = 10/41 (24%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHK----------CSHCNSYNTRST 404 +C++C K H+V HK CS C + +R++ Sbjct: 560 VCSECGKAYISSSHLVQHKKVHTGARPYECSECGKFFSRNS 600
>ZN701_HUMAN (Q9NV72) Zinc finger protein 701| Length = 465 Score = 28.1 bits (61), Expect(2) = 2.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C +R+S + RH Sbjct: 432 HTGEKPYKCNECGKVFNRKSNLERH 456 Score = 21.2 bits (43), Expect(2) = 2.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K + +V HK H Sbjct: 384 CNECGKTFVQNSSLVMHKVIH 404
>ZN578_HUMAN (Q96N58) Zinc finger protein 578| Length = 365 Score = 28.1 bits (61), Expect(2) = 2.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C +++S +SRH Sbjct: 168 HTGEKPYKCNECGKAFNQQSHLSRH 192 Score = 21.2 bits (43), Expect(2) = 2.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K+ + +V HK H Sbjct: 148 CNECGKMFGQNSTLVIHKAIH 168
>ZN75A_HUMAN (Q96N20) Zinc finger protein 75A| Length = 296 Score = 27.3 bits (59), Expect(2) = 2.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C+ C+ + RRS + RH Sbjct: 267 HTGEQPYTCSICRRNFSRRSSLLRH 291 Score = 21.9 bits (45), Expect(2) = 2.5 Identities = 6/21 (28%), Positives = 13/21 (61%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 C++C K + H++ H+ +H Sbjct: 247 CHECGKKFSQNSHLIKHRRTH 267
>ZN492_HUMAN (Q9P255) Zinc finger protein 492 (Fragment)| Length = 574 Score = 30.4 bits (67), Expect = 3.0 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 363 QQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 Q +HL T K+ HTG P C +C + SI++RH Sbjct: 503 QSSHLTTHKM---IHTGEKPYKCEECGKAFNNSSILNRH 538
>ZN271_HUMAN (Q14591) Zinc finger protein 271 (Zinc finger protein HZF7) (Zinc| finger protein ZNFphex133) Length = 498 Score = 30.4 bits (67), Expect = 3.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CNQC H + S V +H Sbjct: 196 HTGEKPYTCNQCNKHFSQSSDVIKH 220
>ZN192_HUMAN (Q15776) Zinc finger protein 192 (LD5-1)| Length = 578 Score = 25.8 bits (55), Expect(2) = 3.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 C++C K H++GH+ SH Sbjct: 464 CDECGKTFRRSSHLIGHQRSH 484 Score = 23.1 bits (48), Expect(2) = 3.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C ++S + H Sbjct: 484 HTGEKPYKCNECGRAFSQKSGLIEH 508
>TRFE_MOUSE (Q921I1) Serotransferrin precursor (Transferrin) (Siderophilin)| (Beta-1-metal-binding globulin) Length = 697 Score = 30.0 bits (66), Expect = 3.9 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%) Frame = -2 Query: 501 GFFAMTATKSQKWTSTWLAISAAIATHTTLDRRRGLQIYQEAVLRRQQTHLKTDKL*RIH 322 G++A+ K+ + TW + + HT +DR G I +L + H K D+ Sbjct: 447 GYYAVAVVKASDTSITWNNLKGKKSCHTGVDRTAGWNI-PMGMLYNRINHCKFDE---FF 502 Query: 321 HTGVSPG------LCNQC 286 G +PG LC+ C Sbjct: 503 SQGCAPGYEKNSTLCDLC 520
>ZN155_HUMAN (Q12901) Zinc finger protein 155| Length = 538 Score = 30.0 bits (66), Expect = 3.9 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C+ C H+RS ++RH Sbjct: 310 HTGEKPFRCDTCDKSFHQRSALNRH 334
>ZN248_HUMAN (Q8NDW4) Zinc finger protein 248| Length = 579 Score = 27.3 bits (59), Expect(2) = 3.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN C +RS++++H Sbjct: 542 HTGEKPYECNACGKTFSQRSVLTKH 566 Score = 21.2 bits (43), Expect(2) = 3.9 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHKCSH 431 +CN+C K V +++ H+ +H Sbjct: 493 ICNECGKSFCVKSNLIVHQRTH 514
>ZNF83_HUMAN (P51522) Zinc finger protein 83 (Zinc finger protein HPF1)| Length = 428 Score = 26.2 bits (56), Expect(2) = 4.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C H+ S +++H Sbjct: 111 HTGEKPYKCNECGKVFHQISHLAQH 135 Score = 24.6 bits (52), Expect(2) = 5.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 R HTG P CN+C R S + +H Sbjct: 136 RTIHTGEKPYECNKCGKVFSRNSYLVQH 163 Score = 23.5 bits (49), Expect(2) = 5.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV FH + H H Sbjct: 119 CNECGKV----FHQISHLAQH 135 Score = 22.3 bits (46), Expect(2) = 4.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV FH + H H Sbjct: 63 CNECGKV----FHNMSHLAQH 79
>ZN184_HUMAN (Q99676) Zinc finger protein 184| Length = 751 Score = 24.3 bits (51), Expect(2) = 4.9 Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 10/40 (25%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGH----------KCSHCNSYNTRST 404 CN C K H+ H KC+ C+ +RST Sbjct: 644 CNKCEKTFSQSSHLTQHQRIHTGEKPYKCNECDKAFSRST 683 Score = 23.9 bits (50), Expect(2) = 4.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 H+G P CN C RS +++H Sbjct: 720 HSGEKPFGCNDCGKSFRYRSALNKH 744
>ZNF96_HUMAN (O43309) Zinc finger protein 96 (Zinc finger protein 305) (Zinc| finger and SCAN domain-containing protein 12) Length = 604 Score = 26.2 bits (56), Expect(2) = 5.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 +I HTG P CN+C R S +++H Sbjct: 321 KIIHTGEKPYKCNECGKAFGRWSALNQH 348 Score = 21.9 bits (45), Expect(2) = 5.0 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 C+DC K H++ H+ H Sbjct: 276 CDDCGKAFSQHSHLIEHQRIH 296
>ZN677_HUMAN (Q86XU0) Zinc finger protein 677| Length = 584 Score = 26.6 bits (57), Expect(2) = 5.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C RS +++H Sbjct: 369 HTGEKPYKCNECDKAFAERSSLTQH 393 Score = 21.6 bits (44), Expect(2) = 5.0 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K H+ GH+ H Sbjct: 349 CNECGKAFIQRSHLWGHERIH 369
>ARS_STRPU (P50473) Arylsulfatase precursor (EC 3.1.6.1) (AS) (Aryl-sulfate| sulphohydrolase) (ARS) Length = 567 Score = 29.6 bits (65), Expect = 5.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 299 CATNARTIHIEEALFRGMARLVVSTPSLGHCRFTILPRFN 180 C +H+++A+ R A +V+ TP L + F+I+P N Sbjct: 495 CGYEHVLLHVKDAIARHDAEMVIGTPVLDNFDFSIIPCCN 534
>ZO19_XENLA (P18742) Oocyte zinc finger protein XLCOF19 (Fragment)| Length = 168 Score = 29.6 bits (65), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C+QC+ + RS ++RH Sbjct: 28 HTGEKPYACSQCEKYFPHRSNLNRH 52
>ZG53_XENLA (P18728) Gastrula zinc finger protein XLCGF53.1 (Fragment)| Length = 516 Score = 29.6 bits (65), Expect = 5.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C+QC+ + RS ++RH Sbjct: 376 HTGEKPYACSQCEKYFPHRSNLNRH 400
>ZFP3_HUMAN (Q96NJ6) Zinc finger protein 3 homolog (Zfp-3)| Length = 502 Score = 26.2 bits (56), Expect(2) = 5.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P LCN+C + S + RH Sbjct: 303 HTGEKPYLCNECGKGFGQSSELIRH 327 Score = 21.9 bits (45), Expect(2) = 5.1 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K V ++ H+ H Sbjct: 255 CNECGKTFRVSSQLIQHQRIH 275
>ZFP3_MOUSE (Q8BLB0) Zinc finger protein 3 (Zfp-3)| Length = 497 Score = 26.2 bits (56), Expect(2) = 5.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P LCN+C + S + RH Sbjct: 298 HTGEKPYLCNECGKGFGQSSELIRH 322 Score = 21.9 bits (45), Expect(2) = 5.1 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C K V ++ H+ H Sbjct: 250 CNECGKTFRVSSQLIQHQRIH 270
>ZN126_HUMAN (P35275) Zinc finger protein 126 (HZF-2) (Fragment)| Length = 98 Score = 26.6 bits (57), Expect(2) = 5.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CNQC + ++ RH Sbjct: 51 HTGEKPYECNQCGKAFSQHGLLQRH 75 Score = 21.9 bits (45), Expect(2) = 5.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN C K H+ HK +H Sbjct: 31 CNQCGKAFSKHSHLQCHKRTH 51
>TRFE_HORSE (P27425) Serotransferrin precursor (Transferrin) (Siderophilin)| (Beta-1 metal-binding globulin) Length = 706 Score = 29.3 bits (64), Expect = 6.6 Identities = 29/100 (29%), Positives = 39/100 (39%), Gaps = 7/100 (7%) Frame = -2 Query: 501 GFFAMTATKSQKWTS-TWLAISAAIATHTTLDRRRGLQIYQEAVLRRQQTHLKTDKL*RI 325 G+ A+ KS TW ++ + HT +DR G I +L + H + DK R Sbjct: 448 GYHAVAVVKSSSDPDLTWNSLKGKKSCHTGVDRTAGWNI-PMGLLYSEIKHCEFDKFFR- 505 Query: 324 HHTGVSPG------LCNQCQNHTHRRSIVSRHGPSSSVNP 223 G +PG LCN C I S GP P Sbjct: 506 --EGCAPGYRRNSTLCNLC--------IGSASGPGRECEP 535
>ZN408_HUMAN (Q9H9D4) Zinc finger protein 408 (PR-domain zinc finger protein 17)| Length = 720 Score = 29.3 bits (64), Expect = 6.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -2 Query: 330 RIHHTGVSPGLCNQCQNHTHRRSIVSRHGPSSSVNPIPGPLP 205 ++ H+G P C+QC RR + H + V P P P Sbjct: 428 QVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCP 469
>ZN133_HUMAN (P52736) Zinc finger protein 133| Length = 654 Score = 29.3 bits (64), Expect = 6.6 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Frame = -2 Query: 363 QQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRHGPSSSVN---PI-PGPLP 205 Q++HL L ++ HTG P +C C +S +SRH ++SV+ P+ P P P Sbjct: 589 QKSHLT---LHQMTHTGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEP 642
>PRLPI_MOUSE (Q9QUN5) Placental prolactin-like protein I precursor (PRL-like| protein I) (PLP-I) (Decidualin) (Prolactin-like protein J) (PRL-like protein J) (PLP-J) Length = 212 Score = 29.3 bits (64), Expect = 6.6 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = -2 Query: 489 MTATKSQKWTSTWLAISAAI----ATHTTLDRRRGLQIYQEAVLRRQQTHLKTDKL*RIH 322 ++ T+++ W +L +S T T DR+ +IY + + H K+ +I Sbjct: 3 LSLTQARTWKGLFLLVSCMFLWVYVTATRYDRKSNEEIYDNLLSSSRHIHRVAKKMYKIL 62 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 + ++ G+C + +N T +S H Sbjct: 63 DSKLTEGVCFRNKN-TKMCQTISTH 86
>POLG_BVDVC (Q96662) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3907 Score = 29.3 bits (64), Expect = 6.6 Identities = 10/39 (25%), Positives = 26/39 (66%) Frame = -3 Query: 356 LILRQTSCREYIILVYHLVCATNARTIHIEEALFRGMAR 240 L+LR+ + ++++IL+YH++ +++ + + GMA+ Sbjct: 1097 LLLREENTKKWVILIYHIIVMHPLKSVTVILLMVGGMAK 1135
>ZN483_HUMAN (Q8TF39) Zinc finger protein 483| Length = 744 Score = 28.9 bits (63), Expect = 8.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 H+G P CNQC+ S++SRH Sbjct: 629 HSGEKPYKCNQCEKAFPTHSLLSRH 653 Score = 23.9 bits (50), Expect(2) = 8.1 Identities = 10/35 (28%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSHCNS--YNTRSTSRP 395 C+DC K + H++ H+ H Y + RP Sbjct: 497 CDDCGKGFTLSAHLIKHQRIHTGEKPYKCKDCGRP 531 Score = 23.5 bits (49), Expect(2) = 8.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P C+ C S +S+H Sbjct: 545 HTGEKPYTCSNCGKSFSHSSSLSKH 569
>ZN544_HUMAN (Q6NX49) Zinc finger protein 544| Length = 715 Score = 25.8 bits (55), Expect(2) = 8.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CNQC R S + H Sbjct: 626 HTGEKPYKCNQCNKAFARSSYLVMH 650 Score = 21.6 bits (44), Expect(2) = 8.1 Identities = 11/40 (27%), Positives = 14/40 (35%), Gaps = 10/40 (25%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHK----------CSHCNSYNTRST 404 C C K + +V HK C+ C RST Sbjct: 578 CTHCGKSFSQSYQLVAHKRTHTGEKPYECNECGKAFNRST 617
>ZN189_HUMAN (O75820) Zinc finger protein 189| Length = 626 Score = 23.9 bits (50), Expect(2) = 8.2 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P LC C R S + H Sbjct: 478 HTGEKPYLCTVCGKSFSRSSFLIEH 502 Score = 23.5 bits (49), Expect(2) = 8.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 C++C K V H+V H+ H Sbjct: 458 CDECGKTFSVSAHLVQHQRIH 478
>ZN615_HUMAN (Q8N8J6) Zinc finger protein 615| Length = 555 Score = 24.3 bits (51), Expect(2) = 8.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P +CN+C +S ++ H Sbjct: 358 HTGEKPYICNECGKGFTEKSHLNVH 382 Score = 23.1 bits (48), Expect(2) = 8.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHKCSH 431 +CNDC K V ++ H+ +H Sbjct: 309 ICNDCGKGFTVKSRLIVHQRTH 330
>ZN480_HUMAN (Q8WV37) Zinc finger protein 480| Length = 516 Score = 25.4 bits (54), Expect(2) = 8.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C R S +++H Sbjct: 486 HTGEKPYKCNECGKAFSRISYLAQH 510 Score = 21.9 bits (45), Expect(2) = 8.3 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -1 Query: 493 CNDCNKVSEVDFHVVGHKCSH 431 CN+C KV H+ H+ H Sbjct: 466 CNECGKVFNRIAHLARHRKIH 486
>Z322A_MOUSE (Q8BZ89) Zinc finger protein 322A| Length = 410 Score = 24.6 bits (52), Expect(2) = 8.5 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -2 Query: 321 HTGVSPGLCNQCQNHTHRRSIVSRH 247 HTG P CN+C+ RS H Sbjct: 215 HTGERPYKCNKCEKSYRHRSAFIVH 239 Score = 22.7 bits (47), Expect(2) = 8.5 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -1 Query: 496 LCNDCNKVSEVDFHVVGHKCSH 431 LCN+C+K +++ H+ +H Sbjct: 166 LCNECDKCFSRSTNLIRHRRTH 187
>ZN678_HUMAN (Q5SXM1) Zinc finger protein 678| Length = 525 Score = 28.9 bits (63), Expect = 8.6 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -2 Query: 366 RQQTHLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 +Q +HL + K RIH TG P C +C ++ SI+S+H Sbjct: 415 KQCSHLTSHK--RIH-TGEKPYKCKECGKAFYQSSILSKH 451
>TSP1_XENLA (P35448) Thrombospondin-1 precursor| Length = 1173 Score = 28.9 bits (63), Expect = 8.6 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 197 W*SGNGPGMGLTLLDGPCRETMLLLCVWFWHWLHRPGDTPV*CILY 334 W +GN PG TL P ++ + WH HRP + ++Y Sbjct: 1084 WHTGNTPGQVRTLWHDPHQKGWKDFTAYRWHLTHRPKTGFIRVVMY 1129
>RNASL_RANCA (P14626) Ribonuclease, liver (EC 3.1.27.5)| Length = 111 Score = 28.9 bits (63), Expect = 8.6 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 3/74 (4%) Frame = -1 Query: 487 DCNKVSEVDFHVVGHKCSHCNSYNTRSTSRPADLXXXXXXXXXXXXXDRQAVENTSY--- 317 DCN + + ++VG KC N++ S DR+ + TS+ Sbjct: 18 DCNTIMDKAIYIVGGKCKERNTFIISSEDN-------VKAICSGVSPDRKELSTTSFKLN 70 Query: 316 WCITWSVQPMPEPY 275 CI S+ P P PY Sbjct: 71 TCIRDSITPRPCPY 84
>ZN205_HUMAN (O95201) Zinc finger protein 205 (Zinc finger protein 210)| Length = 504 Score = 28.9 bits (63), Expect = 8.6 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 321 HTGVSPGLCNQC-QNHTHRRSIVSRHGPSSSVNPIPGPLPLYHFTK 187 HTG P +C++C + T R +V+ G + P P+ FT+ Sbjct: 336 HTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPHKCPICAKCFTQ 381
>ZFP37_RAT (O88553) Zinc finger protein 37 (Zfp-37)| Length = 601 Score = 28.9 bits (63), Expect = 8.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 354 HLKTDKL*RIHHTGVSPGLCNQCQNHTHRRSIVSRH 247 H TD L RI HTG P CN+C S + +H Sbjct: 327 HALTDHL-RISHTGEKPYKCNECGKTFRHSSNLMQH 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,940,129 Number of Sequences: 219361 Number of extensions: 1563115 Number of successful extensions: 6375 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 4683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6372 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)