Clone Name | rbart14b09 |
---|---|
Clone Library Name | barley_pub |
>POLG_CSFVB (P21530) Genome polyprotein [Contains: N-terminal protease (EC| 3.4.22.-) (N-pro) (Autoprotease p20); Capsid protein C; E(rns) glycoprotein (gp44/48); Envelope glycoprotein E1 (gp33); Envelope glycoprotein E2 (gp55); p7; Nonstructural protein 2 Length = 3898 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -3 Query: 151 LCPGESLRGDNQW 113 LCPG SLR DN+W Sbjct: 3267 LCPGSSLRNDNEW 3279
>HQGT_ARATH (Q9M156) Probable hydroquinone glucosyltransferase (EC 2.4.1.218)| (Arbutin synthase) Length = 480 Score = 28.9 bits (63), Expect = 3.6 Identities = 18/30 (60%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 267 RAVKALMERDSEEGKRAREKPAEMK-AACR 181 R VK LME EEGK R K E+K AACR Sbjct: 421 RVVKGLME--GEEGKGVRNKMKELKEAACR 448
>CD5_RAT (P51882) T-cell surface glycoprotein CD5 precursor (Lymphocyte| antigen Ly-1) (Lyt-1) Length = 491 Score = 28.5 bits (62), Expect = 4.7 Identities = 16/62 (25%), Positives = 26/62 (41%) Frame = -3 Query: 187 VQEARRGGRVLLLCPGESLRGDNQWSELVIRECQGVVVAGXXXXXXXXSFRVLCRHREQS 8 + E R+ + LC + RG +W EL + G +++ S VLC + S Sbjct: 286 IAEVRQRSQWAALCDSSAARGPGRWEELCQEQQCGNLISFHVMDADRTSPGVLCTQEKLS 345 Query: 7 AC 2 C Sbjct: 346 QC 347
>TR240_HUMAN (Q9UHV7) Thyroid hormone receptor-associated protein complex 240| kDa component (Trap240) (Thyroid hormone receptor-associated protein 1) (Vitamin D3 receptor-interacting protein complex component DRIP250) (DRIP 250) (Activator-recruited cofac Length = 2174 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 24 RHKTRNDQQEEQELQPATTTPWHSRITNS 110 +HKT Q++ +E Q TP+H R++ S Sbjct: 455 KHKTNEKQEKSEEPQKRPLTPFHHRVSVS 483
>Y413_MYCPN (Q9EXD6) Hypothetical protein MPN413 (A05_orf139)| Length = 139 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 63 LQPATTTPWHS-RITNSLH*LSPRRDSPGQSRRTRPPRR 176 + P+ P+ I LH + P++ SP S +PPRR Sbjct: 64 IPPSPNKPYSKLAINQELHLIPPKKTSPATSSSLKPPRR 102
>CCD45_HUMAN (Q96GE4) Coiled-coil domain-containing protein 45| Length = 821 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +3 Query: 27 HKTRNDQQEEQELQPATTTPWHSRITNSLH*LSPRRDSPGQSRRTRPPRRA 179 HK N EE E T HS + + P++ PG S R +PP R+ Sbjct: 400 HKEENTGNEEVEDGTEETLSQHS---DGIVEYGPKKSRPGLSMRRKPPYRS 447
>MSH6_SCHPO (O74502) DNA mismatch repair protein msh6| Length = 1254 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 7/56 (12%) Frame = +3 Query: 15 SRCRHKTRNDQQEEQELQPATTTPWHSRITNSLH*LSPRR-------DSPGQSRRT 161 S H L P ++ P+ S +++SLH SP+R +SPG+ RT Sbjct: 80 SPSHHANTEIDSSSSMLPPPSSDPFSSPLSSSLHRSSPKRPHDSLGEESPGKLLRT 135
>TPIS_BARHE (Q8L1Z5) Triosephosphate isomerase (EC 5.3.1.1) (TIM)| (Triose-phosphate isomerase) Length = 254 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -3 Query: 187 VQEARRGGRVLLLCPGESL--RGDNQWSELVIRECQGVVVAG 68 VQ A R G V L+C GE+L R N+ +++ R+ +G + G Sbjct: 117 VQAAWRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDG 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,534,005 Number of Sequences: 219361 Number of extensions: 589677 Number of successful extensions: 1793 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1793 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)