Clone Name | rbart13h08 |
---|---|
Clone Library Name | barley_pub |
>ATN1_RAT (P54258) Atrophin-1 (Dentatorubral-pallidoluysian atrophy protein)| Length = 1183 Score = 31.2 bits (69), Expect = 1.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -2 Query: 453 NSSAGLIPPGGASSDQGEPAPQGGAEHFGRRAQQPQDTPREPMTAH 316 N+ G PP G S PAP A H ++ QQPQ P+ H Sbjct: 455 NTHPGPFPPTGGQSTAHPPAP---AHHHHQQQQQPQPQPQPQQHHH 497
>SSXT_MOUSE (Q62280) SSXT protein (SYT protein) (Synovial sarcoma-associated| Ss18-alpha) Length = 418 Score = 30.8 bits (68), Expect = 2.2 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Frame = -2 Query: 465 HGQFNSSAGLIPPGGASSDQGEPAPQG-------GAEHFGRRAQQPQDTPRE 331 H Q S +PPGGA QG+ AP G G+ G+R P P++ Sbjct: 207 HQQPPSQQYNMPPGGAQHYQGQQAPMGLMGQVNQGSHMMGQRQMPPYRPPQQ 258
>RPTN_HUMAN (Q6XPR3) Repetin| Length = 784 Score = 30.0 bits (66), Expect = 3.7 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -2 Query: 423 GASSDQGEPAPQGGAEHFGRRAQQPQ-----DTPREPMTAHFLRRDR 298 G SS G+P Q + H+G+ +Q Q T R+ ++H+ + DR Sbjct: 374 GQSSHYGQPDTQDQSSHYGQTDRQDQSSHYGQTERQGQSSHYSQMDR 420 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = -2 Query: 423 GASSDQGEPAPQGGAEHFGRRAQQPQ-----DTPREPMTAHFLRRDR 298 G SS G+P QG H+G+ +Q Q T R+ ++H+ + D+ Sbjct: 434 GQSSHYGQPDRQGQNSHYGQTDRQGQSSHYGQTDRQGQSSHYSQPDK 480
>ADCY5_RAT (Q04400) Adenylate cyclase type 5 (EC 4.6.1.1) (Adenylate cyclase| type V) (ATP pyrophosphate-lyase 5) (Adenylyl cyclase 5) Length = 1262 Score = 30.0 bits (66), Expect = 3.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 453 NSSAGLIPPGGASSDQGEPAPQGGAEH 373 + S + PPG A+ PAP+GG EH Sbjct: 2 SGSKSVSPPGYAAQTAASPAPRGGPEH 28
>LEG3_HUMAN (P17931) Galectin-3 (Galactose-specific lectin 3) (Mac-2 antigen)| (IgE-binding protein) (35 kDa lectin) (Carbohydrate-binding protein 35) (CBP 35) (Laminin-binding protein) (Lectin L-29) (L-31) (Galactoside-binding protein) (GALBP) Length = 249 Score = 30.0 bits (66), Expect = 3.7 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 409 SGRASPAGWRGAFRPTGSTASGYS*GANDGALP-SP*PGAVP 287 SG +P GW GA+ + A GY + GA P PGA P Sbjct: 13 SGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYP 54
>ATG2_MAGGR (Q51ZN8) Autophagy-related protein 2| Length = 2077 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -2 Query: 453 NSSAGLIPPGGASSDQGEPAPQGGAEHFGRRAQQPQD--TPREP 328 +S A +IPP + + P E R++Q P + TPREP Sbjct: 544 SSPAPIIPPSSDGNTEAGPESSIQGERHDRKSQSPNECLTPREP 587
>APOE_RAT (P02650) Apolipoprotein E precursor (Apo-E)| Length = 312 Score = 29.3 bits (64), Expect = 6.4 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 367 AEMLRATLRGWLA-LI*GGATRWNETSTAVKLSVAPRRIASSTISLQ 504 AE+ +A ++GW L+ +W ++ SVA IAS+T+ L+ Sbjct: 264 AEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLE 310
>HRBL_HUMAN (O95081) HIV-1 Rev-binding protein-like protein (Rev/Rex activation| domain-binding protein-related) (RAB-R) Length = 481 Score = 28.9 bits (63), Expect = 8.3 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 462 GQFNSSAGLIPPGGASSDQGEPAPQGGAE--HFGRRAQQPQDTP 337 G +S G +PP G +S Q +P P G ++ FG P P Sbjct: 268 GPSSSVFGSLPPAGQASFQAQPTPAGSSQGTPFGATPLAPASQP 311
>ADCY5_RABIT (P40144) Adenylate cyclase type 5 (EC 4.6.1.1) (Adenylate cyclase| type V) (ATP pyrophosphate-lyase 5) (Adenylyl cyclase 5) Length = 1264 Score = 28.9 bits (63), Expect = 8.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 453 NSSAGLIPPGGASSDQGEPAPQGGAEH 373 + S G+ PPG A+ PA +GG EH Sbjct: 2 SGSKGVSPPGYAAQTAAAPASRGGPEH 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,076,465 Number of Sequences: 219361 Number of extensions: 1531863 Number of successful extensions: 5265 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 4411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5237 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)