Clone Name | rbart13h01 |
---|---|
Clone Library Name | barley_pub |
>CP307_DROME (Q9VRM7) Cytochrome P450 307a1 (EC 1.14.-.-) (CYPCCCVIIA1) (Spook| protein) Length = 543 Score = 31.2 bits (69), Expect = 1.8 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +3 Query: 279 QLGRQEFNQSPVKIKVLAEKLLGNFWHEYFCSVSDFWEPSNFSRLVKQY 425 +LG Q P+ IK L K N + +Y CS+ ++ +F ++V+ + Sbjct: 188 ELGNQLVPGEPINIKPLILKACANMFSQYMCSLRFDYDDVDFQQIVQYF 236
>MG101_CANAL (Q5AI97) Mitochondrial genome maintenance protein MGM101,| mitochondrial precursor Length = 275 Score = 30.0 bits (66), Expect = 4.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 378 SDFWEPSNFSRLVKQYISGKMIPHGYSKPRCSIWKMPYI 494 S+ W+PS R K+Y + H +K + IWK+ I Sbjct: 227 SELWDPSFIRRWKKKYCEEIFVEHVNTKKKKKIWKLKSI 265
>NAC42_ARATH (Q9SK55) Putative NAC domain-containing protein 42 (ANAC042)| Length = 275 Score = 29.3 bits (64), Expect = 6.9 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = -1 Query: 297 IPVYLVDPSTIPGVSN*R*QFGRDKWTRQ-LCGSEYFTGVSSKLVLFNGFWSRASNPRPV 121 I +Y DP +P VS+ G +W + G +Y V V +GFW +PV Sbjct: 53 IDIYKYDPWDLPRVSS----VGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPV 108 Query: 120 Y 118 Y Sbjct: 109 Y 109
>RR2_NEPOL (Q9TL03) Chloroplast 30S ribosomal protein S2| Length = 272 Score = 28.9 bits (63), Expect = 9.0 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -2 Query: 464 RFGISMWDHLPTYILFDKATEVARLPEIGNGTKVFV 357 R GI + D L T IL DKA AR NG+ +FV Sbjct: 33 RKGIHILDILQTAILLDKARVYARRQAASNGSFLFV 68
>EVI1_MOUSE (P14404) Ecotropic virus integration 1 site protein| Length = 1042 Score = 28.9 bits (63), Expect = 9.0 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = -3 Query: 448 CGIIFPLIYCLTRRLKLLGSQKSETEQKYSCQKLPRSFSAST 323 CG IFP LTR L+ EQ Y C+ RSFS S+ Sbjct: 729 CGKIFPRSANLTRHLRT-----HTGEQPYRCKYCDRSFSISS 765
>THIO3_CORNE (P52228) Thioredoxin C-3| Length = 145 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 521 NKNISFGLVDIGHFPNAAARFGISMWDHLPTYILFDKATEVARL 390 N + F +D P +A F + +PT +L +K TEVAR+ Sbjct: 82 NPYVVFAKIDTEANPRLSAAFNVRS---IPTLVLMNKTTEVARI 122
>EVI1_HUMAN (Q03112) Ecotropic virus integration 1 site protein| Length = 1051 Score = 28.9 bits (63), Expect = 9.0 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = -3 Query: 448 CGIIFPLIYCLTRRLKLLGSQKSETEQKYSCQKLPRSFSAST 323 CG IFP LTR L+ EQ Y C+ RSFS S+ Sbjct: 738 CGKIFPRSANLTRHLRT-----HTGEQPYRCKYCDRSFSISS 774
>PRD16_HUMAN (Q9HAZ2) PR domain zinc finger protein 16 (PR domain-containing| protein 16) (Transcription factor MEL1) Length = 1276 Score = 28.9 bits (63), Expect = 9.0 Identities = 18/42 (42%), Positives = 21/42 (50%) Frame = -3 Query: 448 CGIIFPLIYCLTRRLKLLGSQKSETEQKYSCQKLPRSFSAST 323 CG IFP LTR L+ EQ Y C+ RSFS S+ Sbjct: 956 CGKIFPRSANLTRHLRT-----HTGEQPYRCKYCDRSFSISS 992 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,588,910 Number of Sequences: 219361 Number of extensions: 1765724 Number of successful extensions: 4607 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4607 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)