| Clone Name | rbart13f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CNG13_ARATH (Q9LD40) Putative cyclic nucleotide-gated ion channe... | 32 | 0.43 | 2 | DLG7_MOUSE (Q8K4R9) Discs large homolog 7 (Hepatoma up-regulated... | 28 | 4.8 | 3 | SRP14_YEAST (P38985) Signal recognition particle 14 kDa protein ... | 28 | 8.1 |
|---|
>CNG13_ARATH (Q9LD40) Putative cyclic nucleotide-gated ion channel 13 (Cyclic| nucleotide-and calmodulin-regulated ion channel 13) Length = 696 Score = 32.0 bits (71), Expect = 0.43 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +1 Query: 142 NKPPPQITTSVRNDIEQGLQKPLQKGKHHQLTQSSSS 252 NK P + T ++N + +GL+KPL G H++ S+SS Sbjct: 26 NKARPSLNTVLKN-VRRGLKKPLSFGSHNKKRDSNSS 61
>DLG7_MOUSE (Q8K4R9) Discs large homolog 7 (Hepatoma up-regulated protein| homolog) (HURP) Length = 808 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 6/48 (12%) Frame = +1 Query: 127 PRCNTNKPPPQITTSVRND------IEQGLQKPLQKGKHHQLTQSSSS 252 P C+ N+ P++ ++ D ++QGL+ + K H L Q +S Sbjct: 338 PNCDWNQLRPEVFSTTTQDKANEILVQQGLESLTDRSKEHVLNQKGAS 385
>SRP14_YEAST (P38985) Signal recognition particle 14 kDa protein homolog (SRP14)| Length = 146 Score = 27.7 bits (60), Expect = 8.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 121 NHPRCNTNKPPPQITTSVRNDIEQGLQKPLQKGKHHQLTQSSS 249 NHP + +K +I+ S R+D E L + G H + T+ S+ Sbjct: 53 NHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCST 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.128 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,590,697 Number of Sequences: 219361 Number of extensions: 366841 Number of successful extensions: 645 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)