>PRIMA_HUMAN (Q86XR5) Proline-rich membrane anchor 1 precursor (PRiMA)|
          Length = 153

 Score = 29.6 bits (65), Expect = 3.8
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 11/72 (15%)
 Frame = +2

Query: 11  LHSDPVPNTTSSVCP--------LYIVLQYCCDCTVFYNAATSTCYYGVVG---GRDKNG 157
           L S P PN+TS  CP        L I++  CC   VF       CY  +      +D+NG
Sbjct: 72  LLSAPAPNSTS--CPTEESWWSGLVIIIAVCCASLVFLTVLVIICYKAIKRKPLRKDENG 129

Query: 158 RHLSIADDGLSS 193
              S+A+  +S+
Sbjct: 130 --TSVAEYPMSA 139


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 40,736,133
Number of Sequences: 219361
Number of extensions: 619268
Number of successful extensions: 1369
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1369
length of database: 80,573,946
effective HSP length: 102
effective length of database: 58,199,124
effective search space used: 2909956200
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)