Clone Name | rbart13c04 |
---|---|
Clone Library Name | barley_pub |
>SYR_DROME (Q9VXN4) Probable arginyl-tRNA synthetase (EC 6.1.1.19)| (Arginine--tRNA ligase) (ArgRS) Length = 665 Score = 34.3 bits (77), Expect = 0.086 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 266 EATAVVMRQCFQLLGITPVYKL 201 EATA V+RQCF +LG+ PV K+ Sbjct: 644 EATAAVLRQCFYILGLKPVSKM 665
>AMPO_HUMAN (Q8N6M6) Aminopeptidase O (EC 3.4.11.-) (AP-O)| Length = 819 Score = 29.3 bits (64), Expect = 2.8 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 37 CYIVVS--RCFSSQMRATDSRVC*GGQLGYKDENCNHGN 147 C+I V+ R FSS+M D +C G+ D++ NH N Sbjct: 80 CHIPVTNARTFSSEMEYNDFAICSKGEKDTSDKDGNHDN 118
>NMD3A_HUMAN (Q8TCU5) Glutamate [NMDA] receptor subunit 3A precursor| (N-methyl-D-aspartate receptor subtype NR3A) (NMDAR-L) Length = 1115 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 177 KRSNTGQSQLVNWGDPKQLEALSHDDRRRF 266 KRSN G QL W LSHD+RR++ Sbjct: 1002 KRSNVGPRQLTVWNTSN----LSHDNRRKY 1027
>AMPN_STRLI (Q11010) Aminopeptidase N (EC 3.4.11.2) (Lysyl aminopeptidase)| (Lys-AP) (Alanine aminopeptidase) Length = 857 Score = 28.1 bits (61), Expect = 6.1 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +3 Query: 51 FKMLQFSNEGNRLKSMLGGPTRLQGRKL*PWKHAWGET 164 FK F N RL +LG GR L W AW ET Sbjct: 413 FKRHAFGN--TRLSDLLGALEETSGRDLKTWSKAWLET 448
>HR1A_TRIFL (Q8JIR2) Hemorrhagic metalloproteinase HR1a precursor (EC 3.4.24.-)| [Contains: Disintegrin-like 1a] Length = 609 Score = 27.7 bits (60), Expect = 8.0 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -2 Query: 265 KRRRSSCDNASSCLGSPQFTSCDWPVFDLLHHTFVSPQACFHGYSF 128 + RRS CD A SC G S D P D H + Q C H + + Sbjct: 463 RARRSECDIAESCTGH----SADCPT-DRFHR---NGQPCLHNFGY 500 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,278,810 Number of Sequences: 219361 Number of extensions: 787665 Number of successful extensions: 1698 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1698 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)