| Clone Name | rbart12h07 |
|---|---|
| Clone Library Name | barley_pub |
>YQA3_THEAQ (P74897) Hypothetical 14.6 kDa protein in QAH/OAS sulfhydrylase| 3'region Length = 137 Score = 33.1 bits (74), Expect = 0.36 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIK 356 +VMG R G V +FLGS S + CPV++++ Sbjct: 103 IVMGTRGLGAVGSLFLGSQSQKVVAEAPCPVLLVR 137
>Y1388_SYNY3 (P74148) Hypothetical protein sll1388| Length = 154 Score = 32.7 bits (73), Expect = 0.46 Identities = 14/35 (40%), Positives = 24/35 (68%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIK 356 +V+G R + +FLGSVS+Y I+ V C V++++ Sbjct: 119 VVLGRRGLKGLAEVFLGSVSSYVIHHVQCSVLIVQ 153
>YFK5_SCHPO (P87132) Hypothetical protein C167.05 in chromosome I| Length = 601 Score = 32.3 bits (72), Expect = 0.61 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIK 356 +VMG R +K + LGS SNY +N PV+V + Sbjct: 535 VVMGSRGRSHLKGVLLGSFSNYLVNKSSVPVMVAR 569
>Y2028_MYCBO (P64922) Hypothetical protein Mb2028c| Length = 295 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVI 359 +V+G G + R LGSVS+ + GCPV VI Sbjct: 114 VVLGSSGRGALARGLLGSVSSSLVRRAGCPVAVI 147
>Y2005_MYCTU (P64921) Hypothetical protein Rv2005c/MT2061| Length = 295 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVI 359 +V+G G + R LGSVS+ + GCPV VI Sbjct: 114 VVLGSSGRGALARGLLGSVSSSLVRRAGCPVAVI 147
>Y531_METJA (Q57951) Hypothetical protein MJ0531| Length = 170 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIK 356 +VMG ++R+ LGSV+ I + CPV+V+K Sbjct: 131 IVMGTTGKTGLERILLGSVAERVIKNAHCPVLVVK 165
>YXIE_BACSU (P42297) Hypothetical protein yxiE precursor| Length = 148 Score = 30.4 bits (67), Expect = 2.3 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIK 356 +V+G R +K M LGSVS+ CPV++++ Sbjct: 114 IVVGSRGISGLKEMMLGSVSHKVSQLSTCPVLIVR 148
>Y2346_MYCBO (P64996) Hypothetical protein Mb2346c| Length = 292 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIKG 353 L +G FG V R+FLGS S I PV+V+ G Sbjct: 257 LALGTSPFGDVARVFLGSWSGKIIRYSPVPVLVLPG 292
>Y2319_MYCTU (P64995) Hypothetical protein Rv2319c/MT2382| Length = 292 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVIKG 353 L +G FG V R+FLGS S I PV+V+ G Sbjct: 257 LALGTSPFGDVARVFLGSWSGKIIRYSPVPVLVLPG 292
>CNG_DROME (Q24278) Cyclic nucleotide-gated cation channel (CNG channel)| Length = 665 Score = 29.3 bits (64), Expect = 5.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 179 WMRPKNCSGLYIPCVEIAKL 120 W P+ CS LY+PC I +L Sbjct: 204 WWPPETCSSLYLPCPVIVRL 223
>COBS_RALSO (Q8XWS4) Cobalamin synthase (EC 2.-.-.-)| Length = 258 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 91 GLFPRIPQPTNLAISTHGMYRPEQFFGLI 177 G F RIP P ++ S G+ R +FF L+ Sbjct: 17 GYFTRIPVPASVGFSQDGLNRAARFFPLV 45
>Y1654_SYNY3 (P72817) Hypothetical protein sll1654| Length = 157 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 460 LVMGCRAFGPVKRMFLGSVSNYCINSVGCPVVVI 359 +VMGCR G SV+ IN CPV+V+ Sbjct: 123 IVMGCRGLGLTTEGVAESVTARVINLSPCPVLVV 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,799,008 Number of Sequences: 219361 Number of extensions: 1290066 Number of successful extensions: 3169 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3169 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)