Clone Name | rbart12h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLMU_STRSZ (Q8GQP7) Bifunctional protein glmU [Includes: UDP-N-a... | 30 | 3.1 | 2 | GLMU_ANASP (Q8YQB2) Bifunctional protein glmU [Includes: UDP-N-a... | 29 | 5.2 | 3 | DADA1_PSEAE (Q9HTQ0) D-amino acid dehydrogenase 1 small subunit ... | 28 | 8.9 |
---|
>GLMU_STRSZ (Q8GQP7) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 460 Score = 30.0 bits (66), Expect = 3.1 Identities = 20/54 (37%), Positives = 28/54 (51%) Frame = +2 Query: 107 RLITTSYIQEGSLISDAALWTGSV*IGAGHDQSVGRSCLDGRGLDDGVQLGPHA 268 R+ + S I GS I D+ L G V V +S ++G L DGV +GP+A Sbjct: 285 RIGSRSVITNGSYILDSRLGEGVV---------VSQSVIEGSVLADGVTVGPYA 329
>GLMU_ANASP (Q8YQB2) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 451 Score = 29.3 bits (64), Expect = 5.2 Identities = 24/77 (31%), Positives = 36/77 (46%) Frame = +2 Query: 83 IIKHQDSIRLITTSYIQEGSLISDAALWTGSV*IGAGHDQSVGRSCLDGRGLDDGVQLGP 262 II+ Q +R T IQ GS I +L S G + +V S + + DG ++GP Sbjct: 269 IIEPQTHLRGSTV--IQSGSRIGPGSLIENSQ---LGANVTVHYSVVTDSTIQDGTKIGP 323 Query: 263 HALVPLHVVVGLQLAVG 313 +A + H VG +G Sbjct: 324 YAHLRGHAQVGANCRIG 340
>DADA1_PSEAE (Q9HTQ0) D-amino acid dehydrogenase 1 small subunit (EC 1.4.99.1)| Length = 432 Score = 28.5 bits (62), Expect = 8.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 89 KHQDSIRLITTSYIQEGSLISDAALWTG 172 + ++++ +ITT EG IS A WTG Sbjct: 327 RRRETLEMITTDLYPEGGDISQATFWTG 354 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,483,538 Number of Sequences: 219361 Number of extensions: 1034771 Number of successful extensions: 5009 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5007 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)