| Clone Name | rbart12f06 |
|---|---|
| Clone Library Name | barley_pub |
>GPR37_HUMAN (O15354) Probable G-protein coupled receptor 37 precursor| (Endothelin B receptor-like protein 1) (ETBR-LP-1) (Parkin-associated endothelin receptor-like receptor) (PAELR) Length = 613 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 250 RQTQGSGLRPWPSWALPNAPGSRP 321 R+ QG+ PSW LP APG P Sbjct: 73 REEQGAAFLAGPSWDLPAAPGRDP 96
>RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination protein O)| Length = 234 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 300 WQCPRRPRPKATSLRLAYITNLPEHTHSWLGSSIFV 193 WQ +P P+ SL L ++ +PE H + SS+F+ Sbjct: 103 WQ--EKPSPQLFSLFLNFLQRIPETPHPYFFSSMFL 136
>CT107_HUMAN (Q5JX69) Protein C20orf107 precursor| Length = 171 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -3 Query: 240 NLPEHTHSWLGS 205 NLPEHT WLGS Sbjct: 47 NLPEHTQGWLGS 58
>PGSB2_DROSI (Q70PW6) Peptidoglycan-recognition protein-SB2 precursor (EC| 3.5.1.28) Length = 182 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 209 PSQL*VCSGKLVMYA-KRREVALGLGLLGHCQT 304 PSQ+ + L+ A +RR+V+ L+GHCQT Sbjct: 126 PSQMLQAARTLIQIAVQRRQVSPNYSLVGHCQT 158
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 330 CSWRTTSGSVWQCPRRPRPKATSLR-LAYITNLPEHTHSWLGSSIFV 193 CS T SG +WQC P P S++ A+I+ E + G +V Sbjct: 405 CSSCTCSGGLWQCQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYV 451
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 27.3 bits (59), Expect = 9.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 108 YIQGLAVCITPAFCGTCGPNV 46 +I GL +C+ PA CGPN+ Sbjct: 12 WILGLLLCLGPAAAKVCGPNM 32
>Y147_HAEIN (P44543) Putative TRAP transporter permease protein HI0147| Length = 633 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 291 PRRPRPKATSLRLAYITNLPEHTHSWLGSSIFVAVF 184 P P + + + YI L E WLG ++F+A+F Sbjct: 6 PTFPYSSSNGVSMKYINKLEE----WLGGALFIAIF 37 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,748,951 Number of Sequences: 219361 Number of extensions: 1036718 Number of successful extensions: 2372 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2371 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)