Clone Name | rbart12d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FLPA_SULSO (P58032) Fibrillarin-like pre-rRNA-processing protein | 28 | 9.1 |
---|
>FLPA_SULSO (P58032) Fibrillarin-like pre-rRNA-processing protein| Length = 232 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 130 PNLFPCVVF--FPCAYPSASQNFSFMYI*ILQP 38 PN+FP + FP +Y S +N +Y+ I QP Sbjct: 125 PNIFPLLADARFPQSYKSVVENVDVLYVDIAQP 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,227,052 Number of Sequences: 219361 Number of extensions: 297630 Number of successful extensions: 891 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 891 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)