Clone Name | rbart12b03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GTF2_STRDO (P27470) Glucosyltransferase-I precursor (EC 2.4.1.5)... | 29 | 3.8 | 2 | GTF1_STRDO (P11001) Glucosyltransferase-I precursor (EC 2.4.1.5)... | 29 | 3.8 |
---|
>GTF2_STRDO (P27470) Glucosyltransferase-I precursor (EC 2.4.1.5) (GTF-I)| (Dextransucrase) (Sucrose 6-glucosyltransferase) Length = 1592 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 63 TNEPRKQQNTRGALGSTDARAHTNTNTNTPHGLVTAN*HQ 182 T++ + T+G STD A T TN N + T N +Q Sbjct: 84 TDQASAAEQTQGTTASTDTAAQTTTNANEAKWVPTENENQ 123
>GTF1_STRDO (P11001) Glucosyltransferase-I precursor (EC 2.4.1.5) (GTF-I)| (Dextransucrase) (Sucrose 6-glucosyltransferase) Length = 1597 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 63 TNEPRKQQNTRGALGSTDARAHTNTNTNTPHGLVTAN*HQ 182 T++ + T+G STD A T TN N + T N +Q Sbjct: 90 TDQASAAEQTQGTTASTDTAAQTTTNANEAKWVPTENENQ 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,151,458 Number of Sequences: 219361 Number of extensions: 375775 Number of successful extensions: 1005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 975 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)