Clone Name | rbart12a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DDHC_RHOSU (Q8GPG1) Dimethylsulfide dehydrogenase gamma subunit ... | 29 | 2.9 | 2 | PROB_PROMA (Q7VC78) Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glut... | 28 | 6.5 |
---|
>DDHC_RHOSU (Q8GPG1) Dimethylsulfide dehydrogenase gamma subunit precursor| (Dimethylsulfide heme subunit) (DMS DH gamma subunit) (DMS DH heme subunit) Length = 265 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = -3 Query: 192 AAIDFSNKLDALSYMHVSSDNQSPIVAWF 106 AAI+FS D++SYM + +D +SP+ W+ Sbjct: 132 AAIEFSESDDSVSYM-MGTDAESPVNIWY 159
>PROB_PROMA (Q7VC78) Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase)| (GK) Length = 364 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 1 EKRHNKDPLIKQHATSPLTRLIHSSN*SQALNNGNEPSNNWG 126 +K ++ DP + A P+T +HSSN + + + SNNWG Sbjct: 169 DKLYSSDPKFDKDA-KPITD-VHSSNEIIQIQSNSNESNNWG 208 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,315,190 Number of Sequences: 219361 Number of extensions: 389854 Number of successful extensions: 731 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)