Clone Name | rbart12a01 |
---|---|
Clone Library Name | barley_pub |
>PAT5_SOLTU (P15478) Patatin T5 precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 270 DGAGTNEEALVRFAKRLSEERKLR 199 D T EEAL RFAK LS+ +KLR Sbjct: 357 DNPETYEEALKRFAKLLSDRKKLR 380
>PAT3_SOLTU (P11768) Patatin class 1 precursor (Patatin class I) (Potato tuber| protein) Length = 386 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 270 DGAGTNEEALVRFAKRLSEERKLR 199 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT2_SOLTU (P15477) Patatin B2 precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 270 DGAGTNEEALVRFAKRLSEERKLR 199 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT0_SOLTU (P07745) Patatin precursor (Potato tuber protein)| Length = 386 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 270 DGAGTNEEALVRFAKRLSEERKLR 199 D T EEAL RFAK LS+ +KLR Sbjct: 357 DSPETYEEALKRFAKLLSDRKKLR 380
>PAT1_SOLTU (P15476) Patatin B1 precursor (Potato tuber protein) (Fragment)| Length = 377 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 270 DGAGTNEEALVRFAKRLSEERKLR 199 D T EEAL RFAK LS +KLR Sbjct: 348 DSPETYEEALKRFAKLLSNRKKLR 371
>PURL_SYNP7 (Q55041) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 777 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 202 QLALLGEPLGEADERLFIGASTVDGLIHPIVNGYP 306 +L LLG P AD+RL +G S + H V G P Sbjct: 600 RLYLLGLPTQAADDRLSLGGSEYLAIAHQTVAGLP 634
>PURL_SYNP6 (Q5N1Y6) Phosphoribosylformylglycinamidine synthase II (EC 6.3.5.3)| (FGAM synthase II) Length = 777 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 202 QLALLGEPLGEADERLFIGASTVDGLIHPIVNGYP 306 +L LLG P AD+RL +G S + H V G P Sbjct: 600 RLYLLGLPTQAADDRLSLGGSEYLAIAHQTVAGLP 634
>PATR_THEFY (Q47KH1) Putative phenylalanine aminotransferase (EC 2.6.1.-)| Length = 359 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 Query: 200 AKPTSTPSREEKRDEEALPTMLRDATRCV 114 A P P REE D EAL + D TR V Sbjct: 128 ATPIHVPLREETHDLEALAAAVTDRTRMV 156
>SYW_METMA (Q8PWV5) Tryptophanyl-tRNA synthetase (EC 6.1.1.2)| (Tryptophan--tRNA ligase) (TrpRS) Length = 491 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 306 RVTIDNGMYETVDGAGTNEEALVRFAKRLSEERKLRQTNLN 184 R T + G Y +V G G EAL KR+ + KL + +++ Sbjct: 236 RETAEGGKYLSVRGKGAPREALQELKKRIPGKVKLYEEHID 276
>G45IP_HUMAN (Q8TAE8) Growth arrest and DNA-damage-inducible| proteins-interacting protein 1 (CR6-interacting factor 1) (CRIF1) (CKII beta-associating protein) (Papillomavirus L2-interacting nuclear protein 1) (PLINP-1) Length = 222 Score = 27.3 bits (59), Expect = 9.9 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 229 QEALRGAQVAPNQPQLQVEKRRETKKHYLQCLGMQP 122 QE+LR Q+A Q KRRE ++H +C+ P Sbjct: 100 QESLRVKQLAEEQ------KRREREQHIAECMAKMP 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,788,580 Number of Sequences: 219361 Number of extensions: 648953 Number of successful extensions: 1752 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1752 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)